Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VAE5

Protein Details
Accession A0A316VAE5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-113RTAESHHKVRQRRLINKVRHMBasic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 5, extr 5
Family & Domain DBs
Amino Acid Sequences MKNLSYFFVASFMFSLISLTLQAGVETGVNHVAASSPPSSPKSHGKGINVNEQHVSSGMTSNPKVSARMIAQESSYDKKKAVLNPDSEAFDARTAESHHKVRQRRLINKVRHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.07
4 0.07
5 0.07
6 0.06
7 0.07
8 0.07
9 0.07
10 0.06
11 0.06
12 0.06
13 0.06
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.08
22 0.09
23 0.08
24 0.11
25 0.14
26 0.16
27 0.19
28 0.27
29 0.29
30 0.35
31 0.38
32 0.39
33 0.43
34 0.45
35 0.5
36 0.43
37 0.39
38 0.33
39 0.3
40 0.26
41 0.19
42 0.17
43 0.08
44 0.08
45 0.08
46 0.1
47 0.1
48 0.1
49 0.12
50 0.12
51 0.13
52 0.12
53 0.15
54 0.13
55 0.17
56 0.18
57 0.17
58 0.16
59 0.17
60 0.2
61 0.21
62 0.23
63 0.2
64 0.19
65 0.22
66 0.27
67 0.3
68 0.36
69 0.38
70 0.38
71 0.41
72 0.43
73 0.41
74 0.37
75 0.33
76 0.25
77 0.2
78 0.17
79 0.14
80 0.13
81 0.15
82 0.21
83 0.26
84 0.3
85 0.36
86 0.43
87 0.51
88 0.58
89 0.65
90 0.69
91 0.72
92 0.77
93 0.8