Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VLN7

Protein Details
Accession A0A316VLN7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-82IDTRVFKRRYRHHRGRGRRFGRFRSKFRRLTNKFKHIFBasic
NLS Segment(s)
PositionSequence
51-83KRRYRHHRGRGRRFGRFRSKFRRLTNKFKHIFH
Subcellular Location(s) mito 6plas 6extr 6E.R. 6, pero 2
Family & Domain DBs
Amino Acid Sequences MMLKTFTKALVIQAILSICLNGVVYSAPTNNMLQVRGATLGDVNIDTRVFKRRYRHHRGRGRRFGRFRSKFRRLTNKFKHIFHKRNFLQEKRAINYDEPNLPHRHKKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.12
5 0.07
6 0.07
7 0.07
8 0.05
9 0.05
10 0.04
11 0.05
12 0.07
13 0.07
14 0.08
15 0.1
16 0.1
17 0.12
18 0.13
19 0.13
20 0.12
21 0.12
22 0.12
23 0.11
24 0.11
25 0.08
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.06
33 0.06
34 0.07
35 0.14
36 0.16
37 0.2
38 0.28
39 0.37
40 0.48
41 0.58
42 0.67
43 0.71
44 0.79
45 0.86
46 0.89
47 0.9
48 0.86
49 0.85
50 0.8
51 0.79
52 0.8
53 0.77
54 0.75
55 0.74
56 0.77
57 0.76
58 0.79
59 0.81
60 0.77
61 0.8
62 0.81
63 0.81
64 0.78
65 0.74
66 0.76
67 0.75
68 0.78
69 0.73
70 0.73
71 0.66
72 0.71
73 0.75
74 0.69
75 0.67
76 0.65
77 0.66
78 0.59
79 0.61
80 0.53
81 0.47
82 0.48
83 0.44
84 0.43
85 0.38
86 0.39
87 0.41
88 0.44
89 0.51