Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UQN9

Protein Details
Accession Q2UQN9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
105-131TDSSLSPSTQKRRKTRKDRGLHVEPVFHydrophilic
NLS Segment(s)
PositionSequence
116-120RRKTR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017795  Aro_prenylTrfase_DMATS  
Gene Ontology GO:0016765  F:transferase activity, transferring alkyl or aryl (other than methyl) groups  
GO:0009820  P:alkaloid metabolic process  
Pfam View protein in Pfam  
PF11991  Trp_DMAT  
Amino Acid Sequences MTRAKLEHAWSLGSRLQGPYVEKGLQYLLQLHDHIQISDRELQIKVEHDDRSDTPKTTPLMWNYEMRSEDPSPLTKIYLHVHGENDLKIATGVAHFMEEIGMVDTDSSLSPSTQKRRKTRKDRGLHVEPVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.22
4 0.22
5 0.24
6 0.23
7 0.24
8 0.24
9 0.22
10 0.22
11 0.21
12 0.2
13 0.18
14 0.17
15 0.16
16 0.16
17 0.17
18 0.17
19 0.2
20 0.2
21 0.19
22 0.18
23 0.16
24 0.17
25 0.22
26 0.21
27 0.18
28 0.18
29 0.19
30 0.18
31 0.2
32 0.19
33 0.18
34 0.18
35 0.17
36 0.2
37 0.2
38 0.25
39 0.25
40 0.23
41 0.2
42 0.24
43 0.24
44 0.24
45 0.26
46 0.22
47 0.25
48 0.26
49 0.28
50 0.25
51 0.27
52 0.25
53 0.22
54 0.24
55 0.19
56 0.19
57 0.17
58 0.18
59 0.17
60 0.17
61 0.17
62 0.13
63 0.15
64 0.15
65 0.19
66 0.19
67 0.19
68 0.19
69 0.21
70 0.22
71 0.19
72 0.18
73 0.13
74 0.11
75 0.09
76 0.09
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.04
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.07
95 0.06
96 0.07
97 0.12
98 0.2
99 0.3
100 0.36
101 0.46
102 0.56
103 0.66
104 0.77
105 0.84
106 0.88
107 0.88
108 0.92
109 0.93
110 0.91
111 0.89