Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VDQ6

Protein Details
Accession A0A316VDQ6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-87ETLYSLKKYRTLRRRYIQDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045296  Complex1_LYR_ETFRF1_LYRM5  
Gene Ontology GO:0022904  P:respiratory electron transport chain  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20265  Complex1_LYR_ETFRF1_LYRM5  
Amino Acid Sequences MPPLGHHLRPRAIGLYKELHRLGRDYPDPNYDFIGKLRVMFRKNAHLTDDKEIQQKLDLGDFVRKETETLYSLKKYRTLRRRYIQDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.34
4 0.38
5 0.37
6 0.34
7 0.31
8 0.32
9 0.3
10 0.3
11 0.32
12 0.29
13 0.3
14 0.34
15 0.34
16 0.33
17 0.32
18 0.26
19 0.22
20 0.19
21 0.21
22 0.14
23 0.15
24 0.18
25 0.2
26 0.21
27 0.24
28 0.26
29 0.31
30 0.33
31 0.33
32 0.33
33 0.32
34 0.34
35 0.34
36 0.36
37 0.3
38 0.31
39 0.3
40 0.27
41 0.24
42 0.22
43 0.19
44 0.16
45 0.14
46 0.12
47 0.17
48 0.17
49 0.17
50 0.17
51 0.16
52 0.15
53 0.16
54 0.17
55 0.14
56 0.17
57 0.21
58 0.25
59 0.29
60 0.31
61 0.37
62 0.42
63 0.5
64 0.57
65 0.62
66 0.67
67 0.73