Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VQ42

Protein Details
Accession A0A316VQ42    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAQYRSHKRKIPKERRVGGWRSBasic
NLS Segment(s)
PositionSequence
7-20HKRKIPKERRVGGW
Subcellular Location(s) mito 14, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MAQYRSHKRKIPKERRVGGWRSALNNPGTSKEGRAHARRQLILHGHVIDAFTSTTMNTRVRRWLGLRARHRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.86
4 0.8
5 0.74
6 0.7
7 0.63
8 0.56
9 0.51
10 0.46
11 0.38
12 0.36
13 0.31
14 0.26
15 0.25
16 0.21
17 0.21
18 0.2
19 0.24
20 0.27
21 0.3
22 0.32
23 0.35
24 0.39
25 0.39
26 0.37
27 0.36
28 0.33
29 0.31
30 0.29
31 0.24
32 0.2
33 0.18
34 0.18
35 0.13
36 0.11
37 0.08
38 0.06
39 0.06
40 0.06
41 0.07
42 0.11
43 0.16
44 0.18
45 0.21
46 0.29
47 0.31
48 0.37
49 0.38
50 0.45
51 0.49
52 0.57