Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VLK8

Protein Details
Accession A0A316VLK8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-96KAILAKKSIKKARKNVQLRAQRNHydrophilic
NLS Segment(s)
PositionSequence
79-88KKSIKKARKN
Subcellular Location(s) extr 22, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MLFSQAILFAFATILIIATSTLSSTNEPGPSNEINLPERPRTAINRAQSTTTRHRGNRMVAGQTGGNASNSITKAILAKKSIKKARKNVQLRAQRNSANRGLGKVAPEPGMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.08
11 0.09
12 0.12
13 0.15
14 0.15
15 0.16
16 0.2
17 0.19
18 0.21
19 0.21
20 0.21
21 0.21
22 0.25
23 0.27
24 0.25
25 0.25
26 0.24
27 0.25
28 0.26
29 0.29
30 0.31
31 0.33
32 0.37
33 0.37
34 0.38
35 0.38
36 0.4
37 0.41
38 0.42
39 0.42
40 0.38
41 0.41
42 0.42
43 0.43
44 0.42
45 0.37
46 0.32
47 0.27
48 0.27
49 0.22
50 0.18
51 0.17
52 0.11
53 0.09
54 0.07
55 0.07
56 0.09
57 0.09
58 0.1
59 0.09
60 0.09
61 0.12
62 0.15
63 0.18
64 0.18
65 0.26
66 0.32
67 0.42
68 0.5
69 0.56
70 0.62
71 0.69
72 0.76
73 0.78
74 0.81
75 0.8
76 0.81
77 0.83
78 0.8
79 0.76
80 0.72
81 0.67
82 0.64
83 0.61
84 0.55
85 0.52
86 0.48
87 0.43
88 0.41
89 0.37
90 0.35
91 0.32
92 0.31