Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VJQ9

Protein Details
Accession A0A316VJQ9    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
91-115EESHSTKFSRKERHKKRYLNAKNDPBasic
154-177QRTQKRTMYSRVHRQRQYNKTQNLHydrophilic
184-214VEIARQKKLKQQHYQRFKAKKQAKQEGEQHLHydrophilic
NLS Segment(s)
PositionSequence
100-108RKERHKKRY
Subcellular Location(s) nucl 11, mito 6, golg 4, pero 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MMLIISLFRVAAVFHIFAKGVQSTNDDSPKYQWKALIGSFASSDSSSESETSPRYHKTPETGLKSILPTIPLTIKAAFHDNAVRDPFKNPEESHSTKFSRKERHKKRYLNAKNDPVKWKVVQEKSKARYLRSKELENEMLEKLPKEEKEAYINQRTQKRTMYSRVHRQRQYNKTQNLPTNERLVEIARQKKLKQQHYQRFKAKKQAKQEGEQHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.12
5 0.15
6 0.15
7 0.13
8 0.13
9 0.17
10 0.2
11 0.25
12 0.31
13 0.29
14 0.29
15 0.33
16 0.41
17 0.41
18 0.39
19 0.35
20 0.32
21 0.36
22 0.35
23 0.36
24 0.27
25 0.25
26 0.23
27 0.22
28 0.2
29 0.16
30 0.15
31 0.1
32 0.11
33 0.11
34 0.11
35 0.11
36 0.13
37 0.14
38 0.17
39 0.19
40 0.22
41 0.23
42 0.26
43 0.27
44 0.3
45 0.37
46 0.43
47 0.46
48 0.45
49 0.44
50 0.42
51 0.41
52 0.37
53 0.29
54 0.21
55 0.14
56 0.14
57 0.14
58 0.13
59 0.14
60 0.13
61 0.13
62 0.13
63 0.16
64 0.15
65 0.14
66 0.17
67 0.16
68 0.18
69 0.2
70 0.2
71 0.17
72 0.18
73 0.21
74 0.2
75 0.23
76 0.2
77 0.22
78 0.28
79 0.32
80 0.33
81 0.35
82 0.37
83 0.37
84 0.43
85 0.45
86 0.48
87 0.54
88 0.62
89 0.68
90 0.76
91 0.81
92 0.83
93 0.84
94 0.86
95 0.84
96 0.83
97 0.8
98 0.79
99 0.75
100 0.72
101 0.68
102 0.59
103 0.53
104 0.44
105 0.41
106 0.4
107 0.41
108 0.43
109 0.46
110 0.53
111 0.53
112 0.59
113 0.56
114 0.51
115 0.52
116 0.52
117 0.54
118 0.5
119 0.51
120 0.47
121 0.5
122 0.51
123 0.43
124 0.39
125 0.3
126 0.26
127 0.22
128 0.2
129 0.16
130 0.17
131 0.16
132 0.19
133 0.21
134 0.22
135 0.27
136 0.33
137 0.38
138 0.42
139 0.46
140 0.47
141 0.52
142 0.53
143 0.51
144 0.5
145 0.49
146 0.47
147 0.53
148 0.56
149 0.58
150 0.66
151 0.73
152 0.77
153 0.77
154 0.81
155 0.82
156 0.82
157 0.84
158 0.83
159 0.79
160 0.77
161 0.79
162 0.76
163 0.74
164 0.71
165 0.63
166 0.59
167 0.53
168 0.46
169 0.39
170 0.34
171 0.32
172 0.34
173 0.39
174 0.39
175 0.44
176 0.45
177 0.51
178 0.59
179 0.62
180 0.65
181 0.68
182 0.72
183 0.78
184 0.87
185 0.89
186 0.9
187 0.87
188 0.87
189 0.85
190 0.82
191 0.83
192 0.84
193 0.81
194 0.79