Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VCT9

Protein Details
Accession A0A316VCT9   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
154-179DAEACTKLKKPWPKAHYRKGKALQGLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, nucl 10, cyto 9, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MAQHQHDHQHGPPSAPIPTEEQMALSDANFHAVPLAIDPNTHTLTSPTHDVNVLNALIRSLSALPPQIPIPPPPNVVPPQRSLAINKAKEDGNAAFSKKNYVDAIRMFTLAIDVAASRPLWENNQMARDELAICLANRSAALAEVGDWVGALCDAEACTKLKKPWPKAHYRKGKALQGLGSSTHVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.28
4 0.25
5 0.24
6 0.24
7 0.21
8 0.19
9 0.17
10 0.18
11 0.17
12 0.11
13 0.12
14 0.1
15 0.12
16 0.11
17 0.1
18 0.09
19 0.09
20 0.1
21 0.08
22 0.11
23 0.09
24 0.09
25 0.1
26 0.14
27 0.16
28 0.16
29 0.14
30 0.13
31 0.15
32 0.18
33 0.2
34 0.16
35 0.16
36 0.17
37 0.16
38 0.16
39 0.16
40 0.14
41 0.11
42 0.1
43 0.09
44 0.08
45 0.08
46 0.08
47 0.06
48 0.07
49 0.08
50 0.09
51 0.1
52 0.11
53 0.12
54 0.13
55 0.14
56 0.16
57 0.18
58 0.19
59 0.21
60 0.21
61 0.25
62 0.26
63 0.3
64 0.29
65 0.28
66 0.29
67 0.28
68 0.28
69 0.25
70 0.29
71 0.33
72 0.32
73 0.3
74 0.3
75 0.28
76 0.27
77 0.28
78 0.2
79 0.16
80 0.16
81 0.16
82 0.15
83 0.15
84 0.18
85 0.15
86 0.17
87 0.14
88 0.14
89 0.16
90 0.16
91 0.19
92 0.17
93 0.17
94 0.15
95 0.13
96 0.12
97 0.09
98 0.07
99 0.04
100 0.03
101 0.03
102 0.05
103 0.05
104 0.05
105 0.06
106 0.07
107 0.09
108 0.13
109 0.16
110 0.18
111 0.21
112 0.21
113 0.21
114 0.2
115 0.19
116 0.16
117 0.13
118 0.12
119 0.1
120 0.09
121 0.09
122 0.09
123 0.08
124 0.07
125 0.08
126 0.06
127 0.06
128 0.06
129 0.05
130 0.06
131 0.06
132 0.07
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.04
139 0.03
140 0.03
141 0.04
142 0.05
143 0.07
144 0.09
145 0.12
146 0.16
147 0.22
148 0.3
149 0.39
150 0.48
151 0.57
152 0.65
153 0.74
154 0.8
155 0.86
156 0.89
157 0.86
158 0.87
159 0.85
160 0.83
161 0.78
162 0.72
163 0.65
164 0.57
165 0.53
166 0.44
167 0.38