Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VC88

Protein Details
Accession A0A316VC88   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-71SDEIEKQSPSKKKKKRRHAPNPADETAAHydrophilic
NLS Segment(s)
PositionSequence
52-66PSKKKKKRRHAPNPA
Subcellular Location(s) nucl 14, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MRDIVFRPETTVQRVGPFDEDLLRAAFTVQAGNVPDIDLSLLESDEIEKQSPSKKKKKRRHAPNPADETAAKRSKLNNFAGGMSKSGPGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.29
4 0.26
5 0.22
6 0.19
7 0.19
8 0.15
9 0.15
10 0.13
11 0.1
12 0.1
13 0.09
14 0.07
15 0.07
16 0.06
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.04
26 0.04
27 0.04
28 0.04
29 0.03
30 0.04
31 0.04
32 0.05
33 0.06
34 0.06
35 0.06
36 0.07
37 0.15
38 0.23
39 0.31
40 0.41
41 0.5
42 0.61
43 0.71
44 0.81
45 0.85
46 0.89
47 0.92
48 0.93
49 0.94
50 0.93
51 0.91
52 0.81
53 0.73
54 0.62
55 0.55
56 0.51
57 0.45
58 0.36
59 0.31
60 0.35
61 0.39
62 0.46
63 0.47
64 0.44
65 0.41
66 0.42
67 0.45
68 0.41
69 0.35
70 0.28