Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VKN7

Protein Details
Accession A0A316VKN7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
153-172SRAATRTVREPRKEKPPRKQBasic
NLS Segment(s)
PositionSequence
157-172TRTVREPRKEKPPRKQ
Subcellular Location(s) plas 9, mito 6, extr 6, nucl 3, cyto 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MTMLFLSIPVIAVIWLTISSASPVPGKRARLERQKYSEKGAEKQLGYYPSDSDSYLAEYSSHHVGDVIHSHPNKIMNGMAKIGVDTDKHDMYYGRWGKPPQEGVRIKEPLWYVTNAGQKLRPPPEVHEDLPKASQLGIVRGKTRSDRAAWTGSRAATRTVREPRKEKPPRKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.05
5 0.05
6 0.07
7 0.08
8 0.09
9 0.13
10 0.14
11 0.2
12 0.25
13 0.28
14 0.33
15 0.41
16 0.49
17 0.56
18 0.63
19 0.66
20 0.69
21 0.75
22 0.72
23 0.7
24 0.67
25 0.6
26 0.56
27 0.54
28 0.52
29 0.43
30 0.42
31 0.4
32 0.36
33 0.33
34 0.3
35 0.23
36 0.18
37 0.19
38 0.17
39 0.14
40 0.12
41 0.13
42 0.12
43 0.11
44 0.09
45 0.09
46 0.11
47 0.12
48 0.12
49 0.09
50 0.09
51 0.09
52 0.1
53 0.12
54 0.12
55 0.15
56 0.15
57 0.16
58 0.17
59 0.19
60 0.18
61 0.16
62 0.16
63 0.14
64 0.14
65 0.15
66 0.14
67 0.11
68 0.11
69 0.1
70 0.09
71 0.07
72 0.08
73 0.1
74 0.09
75 0.1
76 0.1
77 0.1
78 0.1
79 0.2
80 0.23
81 0.22
82 0.25
83 0.26
84 0.27
85 0.31
86 0.37
87 0.31
88 0.36
89 0.38
90 0.38
91 0.45
92 0.45
93 0.41
94 0.38
95 0.36
96 0.29
97 0.27
98 0.25
99 0.19
100 0.22
101 0.27
102 0.24
103 0.25
104 0.24
105 0.25
106 0.31
107 0.34
108 0.33
109 0.29
110 0.33
111 0.4
112 0.43
113 0.42
114 0.42
115 0.4
116 0.37
117 0.36
118 0.32
119 0.25
120 0.19
121 0.21
122 0.14
123 0.18
124 0.22
125 0.23
126 0.26
127 0.27
128 0.31
129 0.32
130 0.36
131 0.34
132 0.32
133 0.34
134 0.36
135 0.43
136 0.4
137 0.41
138 0.4
139 0.38
140 0.38
141 0.34
142 0.34
143 0.31
144 0.34
145 0.38
146 0.45
147 0.52
148 0.58
149 0.63
150 0.65
151 0.71
152 0.79