Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VJ71

Protein Details
Accession A0A316VJ71    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-129KEPKKGKKGHHAKVKKPKKPKKEKKPKKEKDHKKPKKAKKPKKEKKPKDPPAAKEPVPBasic
NLS Segment(s)
PositionSequence
69-125PADKEPKKGKKGHHAKVKKPKKPKKEKKPKKEKDHKKPKKAKKPKKEKKPKDPPAAK
Subcellular Location(s) extr 19, E.R. 3, cyto 2, mito 1, cyto_nucl 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MRFNFKLLLALSALAAAASVAAQDAGTTGMDAKPPAQPGPDANTTPAPAGAPQPDPNSQPAPTDPKPMPADKEPKKGKKGHHAKVKKPKKPKKEKKPKKEKDHKKPKKAKKPKKEKKPKDPPAAKEPVPEPGADTQAGTDTTATPPPGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.04
14 0.05
15 0.06
16 0.06
17 0.08
18 0.08
19 0.09
20 0.11
21 0.13
22 0.14
23 0.14
24 0.15
25 0.17
26 0.22
27 0.25
28 0.23
29 0.23
30 0.24
31 0.23
32 0.22
33 0.2
34 0.14
35 0.11
36 0.12
37 0.12
38 0.13
39 0.15
40 0.18
41 0.2
42 0.21
43 0.24
44 0.24
45 0.22
46 0.21
47 0.21
48 0.26
49 0.25
50 0.29
51 0.26
52 0.3
53 0.32
54 0.32
55 0.33
56 0.31
57 0.4
58 0.39
59 0.49
60 0.51
61 0.55
62 0.6
63 0.62
64 0.61
65 0.62
66 0.67
67 0.66
68 0.69
69 0.7
70 0.74
71 0.79
72 0.85
73 0.82
74 0.83
75 0.84
76 0.84
77 0.88
78 0.89
79 0.9
80 0.91
81 0.94
82 0.94
83 0.96
84 0.96
85 0.96
86 0.96
87 0.95
88 0.95
89 0.96
90 0.95
91 0.95
92 0.95
93 0.95
94 0.95
95 0.95
96 0.95
97 0.95
98 0.95
99 0.95
100 0.96
101 0.96
102 0.96
103 0.96
104 0.96
105 0.95
106 0.95
107 0.93
108 0.88
109 0.86
110 0.83
111 0.73
112 0.66
113 0.57
114 0.53
115 0.45
116 0.38
117 0.31
118 0.26
119 0.28
120 0.22
121 0.21
122 0.15
123 0.16
124 0.17
125 0.14
126 0.12
127 0.11
128 0.13
129 0.16