Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316V8B1

Protein Details
Accession A0A316V8B1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
169-201VDDYYAKKRKRDRDYEPRRKQRRKDMFEVDDNYBasic
NLS Segment(s)
PositionSequence
58-85NKKRLKSSPAKKKSSEFYRAKYRRLKER
175-192KKRKRDRDYEPRRKQRRK
Subcellular Location(s) nucl 8, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MYPSIEIPVILLFASLFAQISATKRIRENSLDITTTKAKEPLPFDLNQPAPDDNDGPNKKRLKSSPAKKKSSEFYRAKYRRLKERMQKDPELVQRVQDSKMKYELKKKTKMTEAEKEAHKESVSARNHQQYLRRKAIYGKEVIKQRREVAQIKEQMKFGQVSVEDKKKVDDYYAKKRKRDRDYEPRRKQRRKDMFEVDDNYWPAELSPAHAFQSTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.05
5 0.06
6 0.08
7 0.11
8 0.19
9 0.21
10 0.24
11 0.27
12 0.31
13 0.35
14 0.37
15 0.4
16 0.39
17 0.41
18 0.4
19 0.36
20 0.38
21 0.38
22 0.35
23 0.32
24 0.28
25 0.25
26 0.29
27 0.32
28 0.34
29 0.33
30 0.33
31 0.34
32 0.38
33 0.38
34 0.34
35 0.33
36 0.27
37 0.24
38 0.25
39 0.24
40 0.18
41 0.27
42 0.3
43 0.31
44 0.38
45 0.42
46 0.42
47 0.47
48 0.49
49 0.49
50 0.55
51 0.63
52 0.67
53 0.71
54 0.76
55 0.72
56 0.73
57 0.72
58 0.7
59 0.69
60 0.63
61 0.59
62 0.64
63 0.65
64 0.68
65 0.67
66 0.64
67 0.65
68 0.66
69 0.69
70 0.67
71 0.73
72 0.75
73 0.74
74 0.71
75 0.62
76 0.62
77 0.59
78 0.55
79 0.45
80 0.36
81 0.32
82 0.31
83 0.31
84 0.28
85 0.24
86 0.2
87 0.27
88 0.31
89 0.31
90 0.38
91 0.46
92 0.5
93 0.58
94 0.58
95 0.56
96 0.58
97 0.62
98 0.59
99 0.58
100 0.55
101 0.51
102 0.51
103 0.49
104 0.43
105 0.37
106 0.3
107 0.22
108 0.2
109 0.24
110 0.24
111 0.25
112 0.28
113 0.32
114 0.34
115 0.36
116 0.41
117 0.42
118 0.48
119 0.52
120 0.49
121 0.44
122 0.48
123 0.53
124 0.49
125 0.45
126 0.4
127 0.38
128 0.45
129 0.5
130 0.48
131 0.44
132 0.42
133 0.42
134 0.45
135 0.45
136 0.43
137 0.46
138 0.5
139 0.5
140 0.5
141 0.44
142 0.39
143 0.36
144 0.31
145 0.22
146 0.19
147 0.16
148 0.19
149 0.25
150 0.3
151 0.3
152 0.3
153 0.32
154 0.3
155 0.3
156 0.3
157 0.33
158 0.35
159 0.44
160 0.54
161 0.59
162 0.63
163 0.72
164 0.77
165 0.78
166 0.8
167 0.79
168 0.8
169 0.85
170 0.89
171 0.92
172 0.93
173 0.93
174 0.94
175 0.93
176 0.93
177 0.92
178 0.9
179 0.88
180 0.87
181 0.83
182 0.81
183 0.77
184 0.69
185 0.64
186 0.56
187 0.47
188 0.36
189 0.29
190 0.21
191 0.19
192 0.16
193 0.14
194 0.17
195 0.18
196 0.2
197 0.21