Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VF50

Protein Details
Accession A0A316VF50   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
125-162EFKEKKRIWNKIYRERVRKDPKAHAKCKAKKRLASQSLHydrophilic
NLS Segment(s)
PositionSequence
115-157KKRKRGETLEEFKEKKRIWNKIYRERVRKDPKAHAKCKAKKRL
172-190RHEKHKKDYAEYRKKLNAR
Subcellular Location(s) extr 11, E.R. 6, golg 5, mito 2, nucl 1, pero 1, vacu 1, cyto_mito 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLVRLFHALKRLASFTVFAFLVLSAYAYLFMLLFKECKGAGLSDSANFNIDSWLNIPSDSESEEVNQPILTNSAHSNDGRDHHSLIQPKSTDGHASVPPDNSAYEQSKAGLQLDKKRKRGETLEEFKEKKRIWNKIYRERVRKDPKAHAKCKAKKRLASQSLWSQIKSDPIRHEKHKKDYAEYRKKLNARKNAGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.21
4 0.19
5 0.15
6 0.13
7 0.12
8 0.11
9 0.09
10 0.09
11 0.05
12 0.05
13 0.06
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.07
21 0.07
22 0.09
23 0.09
24 0.1
25 0.11
26 0.11
27 0.11
28 0.14
29 0.15
30 0.15
31 0.16
32 0.15
33 0.15
34 0.14
35 0.14
36 0.11
37 0.11
38 0.09
39 0.09
40 0.11
41 0.1
42 0.1
43 0.1
44 0.09
45 0.1
46 0.1
47 0.1
48 0.09
49 0.1
50 0.12
51 0.12
52 0.11
53 0.1
54 0.09
55 0.09
56 0.1
57 0.08
58 0.07
59 0.08
60 0.1
61 0.12
62 0.12
63 0.13
64 0.14
65 0.16
66 0.18
67 0.18
68 0.18
69 0.18
70 0.22
71 0.26
72 0.25
73 0.27
74 0.24
75 0.23
76 0.23
77 0.21
78 0.18
79 0.14
80 0.16
81 0.14
82 0.16
83 0.17
84 0.16
85 0.16
86 0.15
87 0.14
88 0.12
89 0.13
90 0.12
91 0.12
92 0.12
93 0.12
94 0.12
95 0.13
96 0.13
97 0.13
98 0.14
99 0.22
100 0.33
101 0.4
102 0.45
103 0.5
104 0.5
105 0.52
106 0.55
107 0.55
108 0.55
109 0.55
110 0.57
111 0.59
112 0.59
113 0.55
114 0.57
115 0.49
116 0.47
117 0.48
118 0.5
119 0.5
120 0.58
121 0.66
122 0.69
123 0.79
124 0.8
125 0.81
126 0.77
127 0.8
128 0.81
129 0.8
130 0.76
131 0.76
132 0.78
133 0.79
134 0.8
135 0.8
136 0.8
137 0.81
138 0.85
139 0.85
140 0.82
141 0.79
142 0.82
143 0.83
144 0.8
145 0.75
146 0.71
147 0.69
148 0.7
149 0.65
150 0.56
151 0.46
152 0.4
153 0.44
154 0.42
155 0.38
156 0.38
157 0.45
158 0.52
159 0.6
160 0.69
161 0.69
162 0.76
163 0.78
164 0.74
165 0.74
166 0.78
167 0.79
168 0.8
169 0.76
170 0.74
171 0.74
172 0.78
173 0.78
174 0.77
175 0.76