Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316VCJ1

Protein Details
Accession A0A316VCJ1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MLMRGKMKEEKKKEKERKNEMPAIYBasic
NLS Segment(s)
PositionSequence
5-18GKMKEEKKKEKERK
Subcellular Location(s) mito 12, nucl 10, cyto_nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003422  Cyt_b-c1_6  
IPR023184  Ubol_cytC_Rdtase_hinge_dom  
IPR036811  Ubol_cytC_Rdtase_hinge_dom_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF02320  UCR_hinge  
Amino Acid Sequences MLMRGKMKEEKKKEKERKNEMPAIYEECENSKGCAPAKHHFMECQERVESGNGFKDENCVEEFFHLAHCASECSAPRVFSKLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.91
4 0.91
5 0.88
6 0.86
7 0.76
8 0.69
9 0.61
10 0.55
11 0.46
12 0.36
13 0.28
14 0.21
15 0.22
16 0.19
17 0.18
18 0.15
19 0.15
20 0.17
21 0.21
22 0.24
23 0.26
24 0.31
25 0.32
26 0.3
27 0.3
28 0.32
29 0.35
30 0.32
31 0.3
32 0.25
33 0.23
34 0.24
35 0.23
36 0.2
37 0.14
38 0.17
39 0.15
40 0.15
41 0.14
42 0.16
43 0.15
44 0.16
45 0.16
46 0.13
47 0.12
48 0.13
49 0.14
50 0.11
51 0.11
52 0.11
53 0.09
54 0.09
55 0.1
56 0.1
57 0.11
58 0.15
59 0.16
60 0.18
61 0.21
62 0.22
63 0.22