Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VJS7

Protein Details
Accession A0A316VJS7   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
19-42DIKKAYKKAALKWHPDRNKDNQDAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, mito 8, cyto_nucl 7.5, pero 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002939  DnaJ_C  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR008971  HSP40/DnaJ_pept-bd  
IPR036869  J_dom_sf  
Gene Ontology GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
Pfam View protein in Pfam  
PF00226  DnaJ  
PF01556  DnaJ_C  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
cd10747  DnaJ_C  
Amino Acid Sequences MGADYYKILGISKEATDDDIKKAYKKAALKWHPDRNKDNQDAANKKFKEVGEAFEVLSDKNKRAVYDQYGEEGLKGAAGGGGAGPGAGGFPGGGFPGGGFTFTTSPGGMGGGGGFRPSDPNDIFAHIFGAMGGGGGAGGFSSMFDGMDDGMGGGGSRSRRGGPSMGGMGGMPGGMGGMGGMHGGMGGMGGMPGGMGGFDFGSGGHGHPGGRSESEVEIKDIEKPLQVSLEDLYKGTTKKLKVGKRFLNGEKDEKVLTIDVKPGWKKGTKVRFAGAGNEVSPGKSQDVVFVIDEKPHETFKRVDNDLFTNLQIPLLDALDPPKAGTPGSKKYITTLDGRKIDIPMPRPKAGGTTIPNGGETRVAGEGMPISKTGGKTKGDLVVTWQVELPNRLTDDQRIGVRKVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.23
4 0.25
5 0.27
6 0.31
7 0.32
8 0.33
9 0.36
10 0.38
11 0.4
12 0.44
13 0.49
14 0.53
15 0.61
16 0.68
17 0.74
18 0.79
19 0.81
20 0.83
21 0.82
22 0.81
23 0.82
24 0.78
25 0.75
26 0.71
27 0.72
28 0.71
29 0.7
30 0.69
31 0.6
32 0.55
33 0.54
34 0.47
35 0.46
36 0.4
37 0.39
38 0.34
39 0.35
40 0.33
41 0.29
42 0.3
43 0.21
44 0.26
45 0.25
46 0.21
47 0.26
48 0.27
49 0.26
50 0.29
51 0.36
52 0.36
53 0.39
54 0.39
55 0.36
56 0.36
57 0.35
58 0.31
59 0.25
60 0.17
61 0.11
62 0.1
63 0.07
64 0.05
65 0.05
66 0.05
67 0.03
68 0.04
69 0.03
70 0.03
71 0.03
72 0.02
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.04
81 0.03
82 0.03
83 0.06
84 0.06
85 0.06
86 0.06
87 0.08
88 0.09
89 0.1
90 0.11
91 0.09
92 0.09
93 0.09
94 0.09
95 0.07
96 0.06
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.07
104 0.09
105 0.14
106 0.14
107 0.17
108 0.18
109 0.21
110 0.21
111 0.19
112 0.18
113 0.12
114 0.12
115 0.09
116 0.08
117 0.05
118 0.04
119 0.04
120 0.03
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.05
142 0.05
143 0.06
144 0.07
145 0.09
146 0.1
147 0.12
148 0.14
149 0.13
150 0.16
151 0.16
152 0.15
153 0.14
154 0.13
155 0.1
156 0.08
157 0.07
158 0.04
159 0.02
160 0.02
161 0.02
162 0.02
163 0.01
164 0.01
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.01
179 0.01
180 0.01
181 0.01
182 0.01
183 0.02
184 0.02
185 0.02
186 0.02
187 0.02
188 0.04
189 0.04
190 0.04
191 0.05
192 0.06
193 0.06
194 0.06
195 0.08
196 0.08
197 0.07
198 0.08
199 0.09
200 0.1
201 0.13
202 0.13
203 0.12
204 0.12
205 0.12
206 0.14
207 0.13
208 0.12
209 0.11
210 0.11
211 0.11
212 0.11
213 0.11
214 0.09
215 0.09
216 0.11
217 0.1
218 0.09
219 0.1
220 0.11
221 0.12
222 0.13
223 0.18
224 0.17
225 0.23
226 0.31
227 0.38
228 0.45
229 0.54
230 0.59
231 0.6
232 0.67
233 0.64
234 0.65
235 0.61
236 0.56
237 0.49
238 0.43
239 0.36
240 0.29
241 0.26
242 0.17
243 0.16
244 0.12
245 0.14
246 0.14
247 0.19
248 0.2
249 0.21
250 0.25
251 0.26
252 0.29
253 0.35
254 0.44
255 0.45
256 0.47
257 0.46
258 0.48
259 0.45
260 0.45
261 0.39
262 0.3
263 0.24
264 0.23
265 0.21
266 0.16
267 0.16
268 0.13
269 0.12
270 0.12
271 0.12
272 0.13
273 0.14
274 0.16
275 0.15
276 0.16
277 0.16
278 0.15
279 0.16
280 0.15
281 0.15
282 0.17
283 0.18
284 0.18
285 0.21
286 0.26
287 0.33
288 0.34
289 0.35
290 0.35
291 0.37
292 0.37
293 0.35
294 0.29
295 0.23
296 0.2
297 0.19
298 0.15
299 0.13
300 0.1
301 0.09
302 0.09
303 0.08
304 0.1
305 0.11
306 0.11
307 0.11
308 0.11
309 0.11
310 0.11
311 0.17
312 0.22
313 0.29
314 0.34
315 0.37
316 0.35
317 0.38
318 0.43
319 0.39
320 0.4
321 0.4
322 0.43
323 0.43
324 0.45
325 0.43
326 0.4
327 0.41
328 0.39
329 0.39
330 0.4
331 0.44
332 0.44
333 0.43
334 0.41
335 0.41
336 0.38
337 0.39
338 0.34
339 0.33
340 0.34
341 0.34
342 0.35
343 0.31
344 0.28
345 0.22
346 0.17
347 0.15
348 0.12
349 0.12
350 0.1
351 0.11
352 0.13
353 0.13
354 0.13
355 0.11
356 0.13
357 0.16
358 0.18
359 0.23
360 0.27
361 0.28
362 0.3
363 0.33
364 0.38
365 0.36
366 0.34
367 0.34
368 0.37
369 0.35
370 0.34
371 0.31
372 0.27
373 0.29
374 0.31
375 0.27
376 0.24
377 0.26
378 0.27
379 0.28
380 0.31
381 0.33
382 0.36
383 0.4
384 0.4
385 0.39