Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316VR82

Protein Details
Accession A0A316VR82    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-116DTRMLYKKFLKKPRPFPAGKHydrophilic
NLS Segment(s)
PositionSequence
106-117LKKPRPFPAGKA
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MASLISLSDSLSQWVEQTSEHHDNPVRPVHAKTEKYFEWDNGSAKVKSEGILRPDSNLVSGQIERVPLGPSSHPTFKINFDLLYGDGRKTNFIPVEDTRMLYKKFLKKPRPFPAGKAETKDKKAFQGAYGITYITLSIPTPVWVYIVESVITDIKKRTDVTRDPNLAHRFRTTYVEVNRGYTTFHADMKDKIPRSDVNDVTNKMKANWVNASGLGYLGVHLSQVRNPEKSITWELKFRMYRLDNERYYNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.13
5 0.2
6 0.26
7 0.26
8 0.31
9 0.34
10 0.36
11 0.41
12 0.45
13 0.4
14 0.36
15 0.37
16 0.41
17 0.47
18 0.49
19 0.47
20 0.47
21 0.45
22 0.48
23 0.48
24 0.41
25 0.39
26 0.37
27 0.36
28 0.33
29 0.37
30 0.32
31 0.3
32 0.31
33 0.24
34 0.22
35 0.25
36 0.25
37 0.25
38 0.31
39 0.3
40 0.29
41 0.31
42 0.29
43 0.25
44 0.22
45 0.18
46 0.14
47 0.14
48 0.13
49 0.13
50 0.13
51 0.12
52 0.12
53 0.12
54 0.11
55 0.13
56 0.13
57 0.16
58 0.21
59 0.24
60 0.25
61 0.26
62 0.27
63 0.27
64 0.31
65 0.28
66 0.22
67 0.19
68 0.18
69 0.17
70 0.19
71 0.17
72 0.13
73 0.14
74 0.14
75 0.15
76 0.15
77 0.18
78 0.16
79 0.16
80 0.2
81 0.19
82 0.26
83 0.25
84 0.25
85 0.23
86 0.25
87 0.24
88 0.22
89 0.28
90 0.3
91 0.38
92 0.48
93 0.56
94 0.62
95 0.72
96 0.79
97 0.8
98 0.72
99 0.68
100 0.68
101 0.66
102 0.59
103 0.53
104 0.51
105 0.48
106 0.51
107 0.51
108 0.42
109 0.36
110 0.37
111 0.33
112 0.26
113 0.27
114 0.22
115 0.2
116 0.19
117 0.16
118 0.13
119 0.12
120 0.11
121 0.05
122 0.05
123 0.04
124 0.04
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.07
132 0.08
133 0.08
134 0.08
135 0.07
136 0.08
137 0.09
138 0.1
139 0.09
140 0.09
141 0.1
142 0.12
143 0.14
144 0.16
145 0.22
146 0.28
147 0.35
148 0.43
149 0.45
150 0.44
151 0.51
152 0.55
153 0.49
154 0.44
155 0.4
156 0.33
157 0.31
158 0.35
159 0.29
160 0.3
161 0.32
162 0.36
163 0.34
164 0.34
165 0.33
166 0.29
167 0.27
168 0.2
169 0.23
170 0.18
171 0.2
172 0.19
173 0.2
174 0.23
175 0.27
176 0.34
177 0.3
178 0.29
179 0.31
180 0.32
181 0.37
182 0.43
183 0.41
184 0.39
185 0.44
186 0.45
187 0.45
188 0.45
189 0.39
190 0.31
191 0.34
192 0.3
193 0.29
194 0.3
195 0.29
196 0.28
197 0.27
198 0.28
199 0.22
200 0.2
201 0.15
202 0.11
203 0.08
204 0.07
205 0.07
206 0.06
207 0.07
208 0.08
209 0.1
210 0.18
211 0.23
212 0.24
213 0.26
214 0.29
215 0.3
216 0.36
217 0.42
218 0.41
219 0.39
220 0.43
221 0.44
222 0.5
223 0.51
224 0.45
225 0.47
226 0.43
227 0.48
228 0.5
229 0.58
230 0.53