Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316V0V6

Protein Details
Accession A0A316V0V6    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
35-63FKTGRFKPLRQHPKHKSVRRPAQKGCAANHydrophilic
NLS Segment(s)
PositionSequence
41-54KPLRQHPKHKSVRR
Subcellular Location(s) mito 21, cyto_nucl 3, nucl 2.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MVHPVKGSHLHSLSLRSWVCHPKTRRHVRLLGPCFKTGRFKPLRQHPKHKSVRRPAQKGCAANLDPDRCIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.25
4 0.29
5 0.35
6 0.37
7 0.42
8 0.45
9 0.48
10 0.59
11 0.68
12 0.7
13 0.68
14 0.71
15 0.7
16 0.76
17 0.73
18 0.7
19 0.62
20 0.56
21 0.51
22 0.45
23 0.43
24 0.34
25 0.37
26 0.35
27 0.37
28 0.44
29 0.54
30 0.64
31 0.66
32 0.76
33 0.74
34 0.79
35 0.84
36 0.85
37 0.84
38 0.84
39 0.87
40 0.87
41 0.88
42 0.83
43 0.82
44 0.81
45 0.73
46 0.66
47 0.63
48 0.54
49 0.51
50 0.53
51 0.46