Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9XZX0

Protein Details
Accession A0A2T9XZX0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MKWGFTKTRTKNKLSSKTKKKAKSFAFKRISTHydrophilic
NLS Segment(s)
PositionSequence
9-50RTKNKLSSKTKKKAKSFAFKRISTILNRRNRNNKNSIKIPRD
56-57RK
Subcellular Location(s) mito_nucl 12.999, mito 12.5, nucl 12, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
Amino Acid Sequences MKWGFTKTRTKNKLSSKTKKKAKSFAFKRISTILNRRNRNNKNSIKIPRDWGNTGRKKYGQKISITDIWGKRENKDKTDPRPNTHKSVYSKRKFQNGGDSVTTVFNITPKPHNKSESKISLYAHTLHKDSKNLCKFIHKNRIYEFQSIPFGLKTAPRIFSKIIKAVLEPLRINRVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.84
4 0.87
5 0.9
6 0.91
7 0.89
8 0.88
9 0.87
10 0.87
11 0.85
12 0.85
13 0.84
14 0.75
15 0.7
16 0.65
17 0.59
18 0.55
19 0.57
20 0.55
21 0.56
22 0.61
23 0.65
24 0.72
25 0.76
26 0.76
27 0.76
28 0.76
29 0.75
30 0.78
31 0.79
32 0.74
33 0.69
34 0.67
35 0.64
36 0.6
37 0.55
38 0.53
39 0.54
40 0.56
41 0.56
42 0.55
43 0.54
44 0.54
45 0.58
46 0.6
47 0.55
48 0.5
49 0.5
50 0.5
51 0.48
52 0.45
53 0.43
54 0.36
55 0.35
56 0.38
57 0.35
58 0.33
59 0.39
60 0.4
61 0.39
62 0.47
63 0.5
64 0.52
65 0.62
66 0.63
67 0.59
68 0.65
69 0.64
70 0.6
71 0.56
72 0.53
73 0.48
74 0.55
75 0.6
76 0.56
77 0.61
78 0.58
79 0.63
80 0.6
81 0.56
82 0.55
83 0.48
84 0.46
85 0.38
86 0.35
87 0.28
88 0.25
89 0.24
90 0.13
91 0.11
92 0.08
93 0.09
94 0.1
95 0.17
96 0.22
97 0.28
98 0.31
99 0.37
100 0.39
101 0.42
102 0.49
103 0.49
104 0.47
105 0.44
106 0.41
107 0.39
108 0.38
109 0.37
110 0.32
111 0.27
112 0.25
113 0.27
114 0.29
115 0.32
116 0.33
117 0.39
118 0.42
119 0.43
120 0.43
121 0.49
122 0.53
123 0.58
124 0.66
125 0.59
126 0.58
127 0.59
128 0.68
129 0.61
130 0.59
131 0.51
132 0.44
133 0.44
134 0.39
135 0.35
136 0.26
137 0.23
138 0.19
139 0.19
140 0.21
141 0.22
142 0.26
143 0.27
144 0.31
145 0.33
146 0.39
147 0.42
148 0.42
149 0.41
150 0.38
151 0.37
152 0.41
153 0.44
154 0.43
155 0.38
156 0.37