Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9XXQ4

Protein Details
Accession A0A2T9XXQ4    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-37GSIKAPLKLKERSRKKKSRKREKVDEPELSVBasic
NLS Segment(s)
PositionSequence
11-29APLKLKERSRKKKSRKREK
68-89KFKEVQEKRKRSRIEKLISKSH
Subcellular Location(s) nucl 25.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MSEYDFGSIKAPLKLKERSRKKKSRKREKVDEPELSVEGNVIEVNEERGEIGSKKDVPSDGRTENERKFKEVQEKRKRSRIEKLISKSHKEKVQEFNEKLDRLPEHHDMPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.57
4 0.65
5 0.71
6 0.79
7 0.85
8 0.91
9 0.93
10 0.94
11 0.95
12 0.95
13 0.94
14 0.94
15 0.94
16 0.93
17 0.91
18 0.85
19 0.76
20 0.67
21 0.57
22 0.46
23 0.35
24 0.24
25 0.15
26 0.1
27 0.07
28 0.04
29 0.04
30 0.04
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.07
37 0.07
38 0.08
39 0.1
40 0.11
41 0.12
42 0.13
43 0.14
44 0.15
45 0.18
46 0.21
47 0.2
48 0.21
49 0.24
50 0.28
51 0.32
52 0.38
53 0.36
54 0.35
55 0.36
56 0.39
57 0.46
58 0.5
59 0.56
60 0.59
61 0.69
62 0.72
63 0.77
64 0.79
65 0.74
66 0.76
67 0.74
68 0.72
69 0.72
70 0.72
71 0.74
72 0.73
73 0.74
74 0.69
75 0.66
76 0.62
77 0.57
78 0.57
79 0.57
80 0.61
81 0.64
82 0.6
83 0.62
84 0.63
85 0.59
86 0.53
87 0.49
88 0.41
89 0.34
90 0.39
91 0.36
92 0.35
93 0.39
94 0.42
95 0.38