Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y765

Protein Details
Accession A0A2T9Y765    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-26GETDDDYRKKKSRKREKVDEPELSVBasic
NLS Segment(s)
PositionSequence
9-17RKKKSRKRE
57-78KFKEVQEKRKRSRIEKLISKSH
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences NGETDDDYRKKKSRKREKVDEPELSVEGNVIEVNEERGEIGSKKDVPSDGRTENERKFKEVQEKRKRSRIEKLISKSHKEKVQEFNEKLDRLPEHHDMPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.82
3 0.86
4 0.88
5 0.9
6 0.92
7 0.86
8 0.78
9 0.7
10 0.6
11 0.49
12 0.37
13 0.26
14 0.17
15 0.12
16 0.08
17 0.04
18 0.05
19 0.05
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.08
26 0.08
27 0.09
28 0.11
29 0.13
30 0.13
31 0.15
32 0.16
33 0.17
34 0.2
35 0.23
36 0.22
37 0.22
38 0.25
39 0.29
40 0.32
41 0.38
42 0.35
43 0.33
44 0.34
45 0.37
46 0.44
47 0.49
48 0.55
49 0.58
50 0.68
51 0.71
52 0.76
53 0.78
54 0.73
55 0.74
56 0.73
57 0.71
58 0.7
59 0.7
60 0.73
61 0.72
62 0.73
63 0.68
64 0.65
65 0.61
66 0.56
67 0.56
68 0.56
69 0.6
70 0.63
71 0.59
72 0.61
73 0.63
74 0.59
75 0.53
76 0.49
77 0.41
78 0.34
79 0.39
80 0.35
81 0.35
82 0.39
83 0.42
84 0.38