Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y8W3

Protein Details
Accession A0A2T9Y8W3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-81EKSRGWRKYKDGFKNRPGSHBasic
NLS Segment(s)
Subcellular Location(s) mito 12, pero 4, cyto 3, plas 3, extr 2, cyto_nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018811  Mrx11  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10306  FLILHELTA  
Amino Acid Sequences MNKQLFTSNNIFRVGNILNFGIKGTSKQTFKFSNLDLVSTQSLRFNIPIRKFTSSNGSKTDEKSRGWRKYKDGFKNRPGSHLTAFAILHEVTAIAPIFLIYYVLQEMDLEIPLSENVLKGGNRYINKLREVFGFEKLDEDSKVMVHLVASYGIVKAAMPLRIACCFALTPFVSRRFVEPISRLLGKTLSSAFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.25
3 0.22
4 0.19
5 0.17
6 0.17
7 0.17
8 0.14
9 0.12
10 0.13
11 0.15
12 0.21
13 0.23
14 0.26
15 0.32
16 0.34
17 0.37
18 0.4
19 0.36
20 0.39
21 0.36
22 0.36
23 0.3
24 0.29
25 0.27
26 0.24
27 0.23
28 0.16
29 0.16
30 0.16
31 0.17
32 0.2
33 0.26
34 0.3
35 0.35
36 0.36
37 0.41
38 0.41
39 0.4
40 0.45
41 0.42
42 0.41
43 0.4
44 0.41
45 0.38
46 0.4
47 0.47
48 0.41
49 0.38
50 0.44
51 0.5
52 0.55
53 0.6
54 0.62
55 0.61
56 0.65
57 0.73
58 0.74
59 0.75
60 0.74
61 0.75
62 0.8
63 0.73
64 0.69
65 0.62
66 0.55
67 0.46
68 0.4
69 0.32
70 0.24
71 0.23
72 0.18
73 0.17
74 0.13
75 0.11
76 0.08
77 0.07
78 0.04
79 0.05
80 0.05
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.03
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.04
102 0.04
103 0.05
104 0.07
105 0.07
106 0.07
107 0.11
108 0.16
109 0.17
110 0.22
111 0.27
112 0.29
113 0.33
114 0.33
115 0.31
116 0.28
117 0.33
118 0.3
119 0.29
120 0.27
121 0.23
122 0.24
123 0.23
124 0.23
125 0.17
126 0.16
127 0.11
128 0.1
129 0.1
130 0.09
131 0.08
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.07
143 0.1
144 0.11
145 0.11
146 0.13
147 0.15
148 0.17
149 0.18
150 0.16
151 0.15
152 0.14
153 0.13
154 0.18
155 0.16
156 0.19
157 0.24
158 0.29
159 0.3
160 0.31
161 0.33
162 0.33
163 0.35
164 0.37
165 0.34
166 0.34
167 0.36
168 0.38
169 0.35
170 0.32
171 0.31
172 0.25
173 0.26
174 0.26