Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Z5C0

Protein Details
Accession A0A2T9Z5C0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTMRKRTRIKPRNRGRKPGVVYVHydrophilic
NLS Segment(s)
PositionSequence
4-18RKRTRIKPRNRGRKP
Subcellular Location(s) mito 19, nucl 7, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MTMRKRTRIKPRNRGRKPGVVYVTRTVYPNVHFVTVTPEPVYVTITRPTPMAGESTNNAAPTDQTTQAVPETPTADISI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.87
3 0.87
4 0.81
5 0.79
6 0.75
7 0.67
8 0.62
9 0.56
10 0.51
11 0.42
12 0.38
13 0.3
14 0.25
15 0.23
16 0.23
17 0.2
18 0.17
19 0.16
20 0.15
21 0.2
22 0.19
23 0.18
24 0.14
25 0.13
26 0.12
27 0.13
28 0.14
29 0.08
30 0.09
31 0.11
32 0.11
33 0.12
34 0.12
35 0.12
36 0.11
37 0.11
38 0.11
39 0.1
40 0.11
41 0.12
42 0.15
43 0.16
44 0.16
45 0.16
46 0.14
47 0.14
48 0.15
49 0.18
50 0.16
51 0.16
52 0.15
53 0.17
54 0.18
55 0.2
56 0.17
57 0.16
58 0.16
59 0.16