Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2TX34

Protein Details
Accession Q2TX34    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-31RSESWKASQLEKKRKARRELRQQRGYDAHydrophilic
NLS Segment(s)
PositionSequence
14-24EKKRKARRELR
Subcellular Location(s) nucl 16, cyto 6, mito 4
Family & Domain DBs
KEGG aor:AO090010000306  -  
Amino Acid Sequences MAKRSESWKASQLEKKRKARRELRQQRGYDASAYRQKDAERTRGRASTKTKESYRERVRKYEEFLIEEKNMPEGYKIGEGYPAPTLQELKEFTRWLIESTKGRLADDGRPTKNSIKVRAQEFVPGFFLETGNEISSQDATELYHWIENELVEEGVLSAIRKPKYNFKLRDFERAIIAFWATNDPFFMSGRYRVQFHFITLQFLCTGSRVSSFTPASVDKVGRGLRYKVKLMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.8
4 0.85
5 0.87
6 0.89
7 0.89
8 0.9
9 0.91
10 0.91
11 0.9
12 0.83
13 0.79
14 0.74
15 0.65
16 0.58
17 0.49
18 0.46
19 0.44
20 0.44
21 0.4
22 0.37
23 0.36
24 0.39
25 0.43
26 0.45
27 0.45
28 0.48
29 0.52
30 0.56
31 0.58
32 0.57
33 0.59
34 0.58
35 0.58
36 0.61
37 0.59
38 0.62
39 0.66
40 0.68
41 0.72
42 0.72
43 0.69
44 0.69
45 0.73
46 0.69
47 0.68
48 0.65
49 0.57
50 0.51
51 0.48
52 0.43
53 0.37
54 0.34
55 0.29
56 0.22
57 0.19
58 0.16
59 0.15
60 0.11
61 0.11
62 0.12
63 0.12
64 0.1
65 0.12
66 0.12
67 0.13
68 0.14
69 0.12
70 0.1
71 0.11
72 0.11
73 0.09
74 0.13
75 0.14
76 0.15
77 0.18
78 0.18
79 0.17
80 0.2
81 0.2
82 0.18
83 0.18
84 0.19
85 0.19
86 0.21
87 0.26
88 0.22
89 0.22
90 0.22
91 0.22
92 0.24
93 0.3
94 0.33
95 0.3
96 0.31
97 0.34
98 0.35
99 0.4
100 0.38
101 0.35
102 0.36
103 0.39
104 0.4
105 0.39
106 0.37
107 0.35
108 0.32
109 0.27
110 0.21
111 0.17
112 0.15
113 0.13
114 0.13
115 0.07
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.06
125 0.05
126 0.05
127 0.06
128 0.07
129 0.07
130 0.08
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.07
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.04
144 0.06
145 0.12
146 0.13
147 0.17
148 0.2
149 0.3
150 0.39
151 0.49
152 0.54
153 0.55
154 0.65
155 0.63
156 0.71
157 0.65
158 0.57
159 0.52
160 0.45
161 0.38
162 0.29
163 0.27
164 0.17
165 0.14
166 0.16
167 0.12
168 0.12
169 0.11
170 0.11
171 0.12
172 0.12
173 0.14
174 0.12
175 0.17
176 0.23
177 0.24
178 0.26
179 0.26
180 0.31
181 0.3
182 0.3
183 0.33
184 0.28
185 0.31
186 0.29
187 0.3
188 0.25
189 0.24
190 0.22
191 0.14
192 0.15
193 0.11
194 0.13
195 0.14
196 0.15
197 0.21
198 0.22
199 0.21
200 0.24
201 0.24
202 0.25
203 0.27
204 0.26
205 0.21
206 0.27
207 0.29
208 0.3
209 0.33
210 0.36
211 0.41
212 0.46