Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YJM6

Protein Details
Accession A0A2T9YJM6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
75-115EYQPSQLKRKRKHGFLSRLRTKNGRKVLKRRKLKGRRFLSHBasic
NLS Segment(s)
PositionSequence
82-112KRKRKHGFLSRLRTKNGRKVLKRRKLKGRRF
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MIRLLSNFIVKQSLVQSRAFSSLINKSLGSTTLRTPLNSFQKQISPKISQVNAIQPLANNFTFGTQLRWTTYGQEYQPSQLKRKRKHGFLSRLRTKNGRKVLKRRKLKGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.27
4 0.27
5 0.3
6 0.28
7 0.22
8 0.21
9 0.24
10 0.25
11 0.25
12 0.22
13 0.2
14 0.21
15 0.22
16 0.2
17 0.16
18 0.16
19 0.21
20 0.22
21 0.21
22 0.23
23 0.29
24 0.36
25 0.36
26 0.36
27 0.31
28 0.37
29 0.39
30 0.41
31 0.38
32 0.32
33 0.33
34 0.37
35 0.35
36 0.31
37 0.3
38 0.31
39 0.28
40 0.26
41 0.23
42 0.17
43 0.18
44 0.19
45 0.17
46 0.12
47 0.09
48 0.09
49 0.11
50 0.11
51 0.12
52 0.1
53 0.11
54 0.12
55 0.14
56 0.14
57 0.16
58 0.18
59 0.19
60 0.18
61 0.21
62 0.21
63 0.23
64 0.3
65 0.29
66 0.35
67 0.38
68 0.47
69 0.51
70 0.62
71 0.66
72 0.68
73 0.75
74 0.78
75 0.82
76 0.83
77 0.86
78 0.85
79 0.82
80 0.78
81 0.77
82 0.74
83 0.73
84 0.73
85 0.72
86 0.72
87 0.78
88 0.85
89 0.86
90 0.89
91 0.9
92 0.91
93 0.91
94 0.92
95 0.91