Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Z353

Protein Details
Accession A0A2T9Z353    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-37VTKNKTKSRSYIRRTKKLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR002775  DNA/RNA-bd_Alba-like  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01918  Alba  
Amino Acid Sequences MGKLKPPIYKPAINEIYVTKNKTKSRSYIRRTKKLLLEKKFPCVIINGLGSAVQNAKSVADAVKKELHDQVSLEQEDSIVKVYEEVLSNNKDQIPKISQTEKPSISIQIRLLSNVRNKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.42
4 0.41
5 0.42
6 0.37
7 0.41
8 0.45
9 0.5
10 0.52
11 0.52
12 0.59
13 0.65
14 0.69
15 0.71
16 0.76
17 0.8
18 0.81
19 0.79
20 0.76
21 0.76
22 0.78
23 0.74
24 0.74
25 0.66
26 0.67
27 0.62
28 0.54
29 0.43
30 0.36
31 0.3
32 0.23
33 0.21
34 0.14
35 0.12
36 0.12
37 0.11
38 0.1
39 0.09
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.1
48 0.09
49 0.11
50 0.15
51 0.15
52 0.17
53 0.2
54 0.2
55 0.17
56 0.18
57 0.17
58 0.19
59 0.19
60 0.17
61 0.14
62 0.13
63 0.12
64 0.12
65 0.11
66 0.06
67 0.06
68 0.06
69 0.06
70 0.08
71 0.09
72 0.1
73 0.13
74 0.15
75 0.16
76 0.18
77 0.2
78 0.2
79 0.2
80 0.24
81 0.25
82 0.27
83 0.32
84 0.36
85 0.39
86 0.43
87 0.5
88 0.45
89 0.44
90 0.41
91 0.43
92 0.39
93 0.39
94 0.35
95 0.34
96 0.33
97 0.33
98 0.33
99 0.33