Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9XXZ5

Protein Details
Accession A0A2T9XXZ5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-106IGKAQTTSSKQRKERKNKLKKLRGTAKVKGAKPHydrophilic
NLS Segment(s)
PositionSequence
63-109FEPKHRLIRHGIGKAQTTSSKQRKERKNKLKKLRGTAKVKGAKPKKD
Subcellular Location(s) cyto 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MILDVIHPGLAGVSKNDLREKLAVMYKSDKENVFVFGFKIHYGGGKSTGFALIYDSLDAAKKFEPKHRLIRHGIGKAQTTSSKQRKERKNKLKKLRGTAKVKGAKPKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.21
4 0.22
5 0.23
6 0.24
7 0.25
8 0.25
9 0.28
10 0.27
11 0.27
12 0.32
13 0.32
14 0.33
15 0.35
16 0.3
17 0.27
18 0.27
19 0.27
20 0.23
21 0.2
22 0.17
23 0.15
24 0.15
25 0.13
26 0.12
27 0.09
28 0.09
29 0.1
30 0.1
31 0.12
32 0.11
33 0.11
34 0.11
35 0.12
36 0.1
37 0.09
38 0.1
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.08
48 0.12
49 0.14
50 0.21
51 0.27
52 0.32
53 0.42
54 0.47
55 0.52
56 0.53
57 0.59
58 0.6
59 0.57
60 0.55
61 0.48
62 0.44
63 0.39
64 0.37
65 0.32
66 0.29
67 0.35
68 0.4
69 0.46
70 0.52
71 0.61
72 0.69
73 0.78
74 0.85
75 0.86
76 0.88
77 0.9
78 0.93
79 0.94
80 0.92
81 0.92
82 0.91
83 0.89
84 0.86
85 0.83
86 0.82
87 0.81
88 0.77
89 0.77