Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y178

Protein Details
Accession A0A2T9Y178    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
149-168GGNSSKKKTAKARANPWTSAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 11.5, nucl 10.5, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences QPDAGNVVSLKCMFCIHFGRDGPDNDESYLEEKRKLTSSIKLFETFRIKIKSYLSGQHGKLWKRYLAKYTKTIPARFSVEKPLEIVIKSLIVKTIIGKLLSQPDDSSHDNFLILKNLFSKCTDPNSSETNYKIVIKPTRSLLLWMDGIGGNSSKKKTAKARANPWTSALKISHPDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.23
4 0.29
5 0.3
6 0.33
7 0.37
8 0.38
9 0.37
10 0.36
11 0.34
12 0.27
13 0.27
14 0.24
15 0.22
16 0.25
17 0.22
18 0.22
19 0.22
20 0.24
21 0.26
22 0.28
23 0.29
24 0.32
25 0.37
26 0.38
27 0.41
28 0.41
29 0.4
30 0.41
31 0.44
32 0.38
33 0.38
34 0.37
35 0.35
36 0.35
37 0.36
38 0.37
39 0.33
40 0.37
41 0.36
42 0.39
43 0.38
44 0.41
45 0.45
46 0.41
47 0.43
48 0.4
49 0.4
50 0.38
51 0.4
52 0.42
53 0.44
54 0.46
55 0.47
56 0.48
57 0.51
58 0.51
59 0.5
60 0.43
61 0.39
62 0.4
63 0.36
64 0.34
65 0.34
66 0.3
67 0.28
68 0.27
69 0.24
70 0.2
71 0.18
72 0.17
73 0.09
74 0.09
75 0.09
76 0.08
77 0.08
78 0.07
79 0.07
80 0.07
81 0.1
82 0.1
83 0.1
84 0.1
85 0.11
86 0.16
87 0.17
88 0.17
89 0.14
90 0.14
91 0.19
92 0.21
93 0.21
94 0.17
95 0.16
96 0.15
97 0.16
98 0.15
99 0.15
100 0.13
101 0.12
102 0.15
103 0.16
104 0.17
105 0.18
106 0.2
107 0.18
108 0.24
109 0.26
110 0.25
111 0.27
112 0.3
113 0.32
114 0.32
115 0.3
116 0.26
117 0.25
118 0.25
119 0.24
120 0.27
121 0.31
122 0.31
123 0.33
124 0.34
125 0.36
126 0.34
127 0.34
128 0.29
129 0.26
130 0.23
131 0.21
132 0.19
133 0.15
134 0.15
135 0.14
136 0.13
137 0.12
138 0.15
139 0.17
140 0.21
141 0.23
142 0.3
143 0.39
144 0.48
145 0.57
146 0.63
147 0.72
148 0.77
149 0.81
150 0.75
151 0.69
152 0.65
153 0.56
154 0.51
155 0.42
156 0.36