Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YYU0

Protein Details
Accession A0A2T9YYU0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
13-32VEKKREFYKRRSEIKTEIKQBasic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Pfam View protein in Pfam  
PF08598  Sds3  
Amino Acid Sequences MERLRDIEQQDFVEKKREFYKRRSEIKTEIKQILLGVHPVFNEMVSKLERTRDRELELARSMFDYKMRQFDQELKSQRAQALIDFENERKQLINQLVANIEEKRRKIKDEKDSLEVTSDYLLETSRGSNKRSLRNRGLDTVQNSGPKPGNNYTSNARRKQTLNFPINGLAEEEIISDLVQIRKYTGVVGPLALPTTSKKNLKSNKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.42
4 0.49
5 0.5
6 0.56
7 0.66
8 0.66
9 0.76
10 0.79
11 0.76
12 0.76
13 0.8
14 0.8
15 0.76
16 0.69
17 0.59
18 0.53
19 0.47
20 0.39
21 0.3
22 0.24
23 0.17
24 0.16
25 0.15
26 0.15
27 0.15
28 0.12
29 0.12
30 0.09
31 0.11
32 0.11
33 0.13
34 0.13
35 0.21
36 0.26
37 0.31
38 0.38
39 0.38
40 0.4
41 0.43
42 0.43
43 0.42
44 0.4
45 0.34
46 0.27
47 0.25
48 0.23
49 0.19
50 0.2
51 0.19
52 0.18
53 0.24
54 0.25
55 0.25
56 0.26
57 0.33
58 0.34
59 0.38
60 0.41
61 0.38
62 0.39
63 0.4
64 0.39
65 0.32
66 0.29
67 0.21
68 0.21
69 0.17
70 0.18
71 0.17
72 0.17
73 0.18
74 0.18
75 0.17
76 0.13
77 0.13
78 0.16
79 0.16
80 0.19
81 0.16
82 0.17
83 0.17
84 0.17
85 0.19
86 0.14
87 0.16
88 0.16
89 0.17
90 0.22
91 0.23
92 0.27
93 0.33
94 0.4
95 0.47
96 0.53
97 0.55
98 0.54
99 0.53
100 0.49
101 0.44
102 0.35
103 0.25
104 0.16
105 0.12
106 0.07
107 0.06
108 0.06
109 0.05
110 0.05
111 0.07
112 0.13
113 0.16
114 0.18
115 0.24
116 0.3
117 0.39
118 0.47
119 0.55
120 0.55
121 0.61
122 0.62
123 0.6
124 0.58
125 0.53
126 0.47
127 0.43
128 0.38
129 0.34
130 0.3
131 0.3
132 0.28
133 0.25
134 0.27
135 0.27
136 0.31
137 0.29
138 0.32
139 0.36
140 0.44
141 0.51
142 0.52
143 0.5
144 0.48
145 0.49
146 0.53
147 0.56
148 0.56
149 0.54
150 0.49
151 0.49
152 0.48
153 0.46
154 0.39
155 0.3
156 0.2
157 0.14
158 0.13
159 0.11
160 0.08
161 0.08
162 0.07
163 0.06
164 0.09
165 0.11
166 0.13
167 0.13
168 0.14
169 0.15
170 0.15
171 0.17
172 0.16
173 0.17
174 0.15
175 0.16
176 0.16
177 0.15
178 0.16
179 0.14
180 0.13
181 0.13
182 0.2
183 0.27
184 0.32
185 0.37
186 0.46