Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Z2F5

Protein Details
Accession A0A2T9Z2F5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-97ASPSPVSGKKKCRHRRRHRRHGTKRHGTRRHGKGRHGKKHHRRRHHKSHAPAPTQSBasic
NLS Segment(s)
PositionSequence
49-90GKKKCRHRRRHRRHGTKRHGTRRHGKGRHGKKHHRRRHHKSH
Subcellular Location(s) mito 14, extr 6, cyto 4, nucl 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MNKFYILGLVSSVLVSAQFYQATPVVAPVAPAPVAAAPVADASPSPVSGKKKCRHRRRHRRHGTKRHGTRRHGKGRHGKKHHRRRHHKSHAPAPTQSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.07
6 0.07
7 0.09
8 0.1
9 0.11
10 0.1
11 0.1
12 0.1
13 0.09
14 0.1
15 0.08
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.06
31 0.06
32 0.07
33 0.11
34 0.15
35 0.22
36 0.31
37 0.36
38 0.46
39 0.57
40 0.67
41 0.74
42 0.82
43 0.87
44 0.9
45 0.95
46 0.95
47 0.96
48 0.97
49 0.97
50 0.96
51 0.95
52 0.95
53 0.94
54 0.91
55 0.88
56 0.87
57 0.86
58 0.86
59 0.81
60 0.8
61 0.8
62 0.82
63 0.85
64 0.85
65 0.86
66 0.86
67 0.92
68 0.93
69 0.93
70 0.94
71 0.93
72 0.94
73 0.94
74 0.93
75 0.92
76 0.92
77 0.91
78 0.86