Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YZN2

Protein Details
Accession A0A2T9YZN2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-56TLNSQKIQKKSNRHGVHKKPKLSNFFEHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 8, golg 6, mito 5, plas 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002659  Glyco_trans_31  
Gene Ontology GO:0016020  C:membrane  
GO:0016758  F:hexosyltransferase activity  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF01762  Galactosyl_T  
Amino Acid Sequences MKAFGVYINRKKGKRIFILSLILISLLVFTLNSQKIQKKSNRHGVHKKPKLSNFFEDEPGIDFSSSAELDSLEFDKVSYRDITLNSNIAFIPRNKKLDMEEIFHEYLIIIPLAKTESIVWLRNLYSDLNLKILCDVDDLRSGCDIRTKNAYTYDTLPLKTYDMMKILCHSKDRYKVIVKMDFDIFINKFYFYNILKFLIKNSSRKIYYGDPMISNRVMMDLSMNGKVYAFTNPVLRDYCSCDIKRPTSGGLEDLWFGNNLVQCINSKNYKNKNEELFLLFSKEHHIYHKSFENNNVKLNTGSSVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.65
4 0.64
5 0.67
6 0.59
7 0.51
8 0.41
9 0.31
10 0.23
11 0.16
12 0.1
13 0.05
14 0.05
15 0.04
16 0.04
17 0.12
18 0.14
19 0.17
20 0.22
21 0.29
22 0.34
23 0.43
24 0.51
25 0.54
26 0.63
27 0.71
28 0.75
29 0.79
30 0.85
31 0.87
32 0.9
33 0.89
34 0.88
35 0.86
36 0.85
37 0.83
38 0.79
39 0.75
40 0.7
41 0.64
42 0.58
43 0.49
44 0.42
45 0.36
46 0.31
47 0.25
48 0.17
49 0.14
50 0.12
51 0.13
52 0.13
53 0.1
54 0.08
55 0.07
56 0.07
57 0.09
58 0.1
59 0.08
60 0.08
61 0.08
62 0.11
63 0.11
64 0.13
65 0.12
66 0.12
67 0.15
68 0.16
69 0.2
70 0.19
71 0.22
72 0.2
73 0.2
74 0.18
75 0.17
76 0.18
77 0.18
78 0.23
79 0.26
80 0.29
81 0.28
82 0.3
83 0.31
84 0.37
85 0.37
86 0.33
87 0.3
88 0.31
89 0.31
90 0.29
91 0.27
92 0.18
93 0.15
94 0.12
95 0.1
96 0.05
97 0.04
98 0.05
99 0.06
100 0.06
101 0.06
102 0.05
103 0.1
104 0.12
105 0.14
106 0.14
107 0.15
108 0.16
109 0.16
110 0.17
111 0.13
112 0.12
113 0.13
114 0.13
115 0.13
116 0.13
117 0.13
118 0.12
119 0.12
120 0.1
121 0.08
122 0.08
123 0.08
124 0.12
125 0.12
126 0.12
127 0.13
128 0.13
129 0.12
130 0.17
131 0.16
132 0.14
133 0.2
134 0.2
135 0.21
136 0.25
137 0.26
138 0.22
139 0.24
140 0.28
141 0.24
142 0.23
143 0.22
144 0.19
145 0.18
146 0.18
147 0.16
148 0.12
149 0.12
150 0.13
151 0.12
152 0.14
153 0.16
154 0.16
155 0.18
156 0.2
157 0.23
158 0.3
159 0.33
160 0.37
161 0.38
162 0.42
163 0.45
164 0.48
165 0.43
166 0.38
167 0.35
168 0.3
169 0.26
170 0.25
171 0.19
172 0.15
173 0.14
174 0.13
175 0.12
176 0.12
177 0.15
178 0.12
179 0.15
180 0.14
181 0.17
182 0.17
183 0.18
184 0.19
185 0.25
186 0.27
187 0.3
188 0.32
189 0.37
190 0.36
191 0.37
192 0.39
193 0.34
194 0.34
195 0.34
196 0.32
197 0.27
198 0.28
199 0.3
200 0.27
201 0.22
202 0.19
203 0.14
204 0.12
205 0.09
206 0.09
207 0.08
208 0.1
209 0.11
210 0.11
211 0.11
212 0.11
213 0.11
214 0.11
215 0.12
216 0.12
217 0.12
218 0.16
219 0.17
220 0.19
221 0.21
222 0.21
223 0.2
224 0.25
225 0.3
226 0.32
227 0.32
228 0.36
229 0.42
230 0.44
231 0.46
232 0.41
233 0.39
234 0.36
235 0.36
236 0.31
237 0.26
238 0.23
239 0.2
240 0.18
241 0.16
242 0.12
243 0.11
244 0.13
245 0.12
246 0.12
247 0.11
248 0.12
249 0.12
250 0.16
251 0.21
252 0.25
253 0.3
254 0.39
255 0.49
256 0.57
257 0.63
258 0.67
259 0.68
260 0.65
261 0.63
262 0.57
263 0.51
264 0.44
265 0.4
266 0.33
267 0.26
268 0.28
269 0.27
270 0.24
271 0.26
272 0.3
273 0.28
274 0.34
275 0.42
276 0.44
277 0.45
278 0.53
279 0.58
280 0.55
281 0.6
282 0.56
283 0.49
284 0.43
285 0.41