Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YIB8

Protein Details
Accession A0A2T9YIB8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MAPAAKPSSKGKKKWSKGKTKDKVNNAITFHydrophilic
NLS Segment(s)
PositionSequence
6-21KPSSKGKKKWSKGKTK
Subcellular Location(s) nucl 13, mito_nucl 11.333, cyto_nucl 9.333, mito 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAKPSSKGKKKWSKGKTKDKVNNAITFDNNTLEKVKKEIPAYKLITPSVLVDRLRINGSLARKALRELCEMGSIKLVSAHGSQMIYTRAVAAPVVEAEVVAQPTKKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.86
4 0.88
5 0.92
6 0.91
7 0.91
8 0.9
9 0.88
10 0.88
11 0.82
12 0.77
13 0.69
14 0.62
15 0.52
16 0.46
17 0.38
18 0.3
19 0.25
20 0.2
21 0.19
22 0.18
23 0.17
24 0.18
25 0.2
26 0.22
27 0.26
28 0.31
29 0.31
30 0.38
31 0.4
32 0.39
33 0.38
34 0.33
35 0.3
36 0.24
37 0.22
38 0.16
39 0.16
40 0.13
41 0.12
42 0.13
43 0.14
44 0.14
45 0.13
46 0.12
47 0.12
48 0.14
49 0.16
50 0.16
51 0.16
52 0.16
53 0.17
54 0.21
55 0.2
56 0.2
57 0.19
58 0.19
59 0.23
60 0.24
61 0.22
62 0.21
63 0.18
64 0.16
65 0.15
66 0.14
67 0.11
68 0.11
69 0.11
70 0.1
71 0.1
72 0.1
73 0.11
74 0.13
75 0.11
76 0.11
77 0.12
78 0.1
79 0.11
80 0.11
81 0.09
82 0.08
83 0.08
84 0.08
85 0.06
86 0.06
87 0.06
88 0.08
89 0.1
90 0.1
91 0.11
92 0.12