Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YCW9

Protein Details
Accession A0A2T9YCW9    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MEKSLETVKRRNHGRNKKGRGHTNPVRCDNHydrophilic
96-119GRRVRTPPPRVRFNKDGKKINPNAHydrophilic
NLS Segment(s)
PositionSequence
9-20KRRNHGRNKKGR
102-107PPPRVR
Subcellular Location(s) nucl 15.5, mito_nucl 10, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MEKSLETVKRRNHGRNKKGRGHTNPVRCDNCSRCCPKDKSVKRFTVRNMVEAAAQRDMADASVYEAYALPKLYIKVHYCIACAIHNHIVRVRSSVGRRVRTPPPRVRFNKDGKKINPNAAKETAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.87
4 0.89
5 0.9
6 0.9
7 0.87
8 0.86
9 0.85
10 0.83
11 0.82
12 0.8
13 0.74
14 0.66
15 0.66
16 0.62
17 0.6
18 0.58
19 0.57
20 0.53
21 0.59
22 0.61
23 0.61
24 0.66
25 0.69
26 0.71
27 0.73
28 0.78
29 0.73
30 0.74
31 0.69
32 0.69
33 0.59
34 0.51
35 0.43
36 0.34
37 0.32
38 0.28
39 0.26
40 0.16
41 0.15
42 0.12
43 0.11
44 0.1
45 0.08
46 0.06
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.05
57 0.06
58 0.08
59 0.09
60 0.13
61 0.15
62 0.17
63 0.2
64 0.21
65 0.2
66 0.2
67 0.2
68 0.18
69 0.16
70 0.18
71 0.22
72 0.22
73 0.23
74 0.25
75 0.25
76 0.24
77 0.25
78 0.24
79 0.23
80 0.25
81 0.32
82 0.37
83 0.41
84 0.44
85 0.47
86 0.55
87 0.59
88 0.65
89 0.67
90 0.67
91 0.73
92 0.76
93 0.79
94 0.79
95 0.8
96 0.81
97 0.8
98 0.82
99 0.78
100 0.81
101 0.78
102 0.79
103 0.76
104 0.7
105 0.67