Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YYY2

Protein Details
Accession A0A2T9YYY2   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-59SHVIVKSKQNSKLPKKKIRKPSGSKKYTPKPNEHydrophilic
NLS Segment(s)
PositionSequence
21-52KQKKMSSHVIVKSKQNSKLPKKKIRKPSGSKK
Subcellular Location(s) nucl 16, mito_nucl 12.666, cyto_nucl 11.166, mito 7
Family & Domain DBs
Amino Acid Sequences MLVARKKIKSNTGTPTSLYKKQKKMSSHVIVKSKQNSKLPKKKIRKPSGSKKYTPKPNETIFPFNDRFTDYLHTIQTKFYTKEWDIWWKLVQVKSKPDYLELMKETEKLFRLKIQAQNLSPVPPTSASSTIPTVPASFSALFVSSAKLNSTSTTFFSIGNQPSSYIKGKKTVSDSKNKNIMAQTALQTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.56
4 0.58
5 0.6
6 0.6
7 0.62
8 0.68
9 0.74
10 0.71
11 0.73
12 0.75
13 0.75
14 0.75
15 0.73
16 0.73
17 0.7
18 0.71
19 0.72
20 0.68
21 0.65
22 0.64
23 0.67
24 0.7
25 0.76
26 0.79
27 0.81
28 0.84
29 0.87
30 0.9
31 0.9
32 0.9
33 0.9
34 0.91
35 0.91
36 0.88
37 0.86
38 0.85
39 0.84
40 0.84
41 0.79
42 0.75
43 0.71
44 0.67
45 0.66
46 0.62
47 0.58
48 0.49
49 0.5
50 0.44
51 0.37
52 0.34
53 0.29
54 0.25
55 0.2
56 0.22
57 0.17
58 0.18
59 0.19
60 0.2
61 0.19
62 0.19
63 0.2
64 0.2
65 0.2
66 0.18
67 0.23
68 0.22
69 0.26
70 0.28
71 0.33
72 0.31
73 0.31
74 0.31
75 0.27
76 0.3
77 0.29
78 0.31
79 0.26
80 0.31
81 0.31
82 0.33
83 0.31
84 0.28
85 0.28
86 0.24
87 0.25
88 0.19
89 0.2
90 0.17
91 0.19
92 0.18
93 0.18
94 0.19
95 0.16
96 0.16
97 0.17
98 0.2
99 0.25
100 0.3
101 0.33
102 0.36
103 0.35
104 0.39
105 0.37
106 0.34
107 0.29
108 0.23
109 0.18
110 0.14
111 0.15
112 0.14
113 0.15
114 0.15
115 0.16
116 0.18
117 0.17
118 0.17
119 0.16
120 0.14
121 0.12
122 0.11
123 0.13
124 0.11
125 0.11
126 0.11
127 0.11
128 0.12
129 0.11
130 0.12
131 0.1
132 0.11
133 0.11
134 0.11
135 0.11
136 0.12
137 0.14
138 0.14
139 0.15
140 0.19
141 0.19
142 0.18
143 0.2
144 0.26
145 0.26
146 0.28
147 0.26
148 0.23
149 0.24
150 0.29
151 0.32
152 0.3
153 0.3
154 0.34
155 0.36
156 0.41
157 0.47
158 0.53
159 0.55
160 0.61
161 0.65
162 0.67
163 0.73
164 0.68
165 0.64
166 0.57
167 0.53
168 0.45
169 0.43