Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Z2S5

Protein Details
Accession A0A2T9Z2S5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKSSSNTRKPRRSHKERIKTWKIDIPHydrophilic
NLS Segment(s)
PositionSequence
8-18RKPRRSHKERI
Subcellular Location(s) nucl 20.5, mito_nucl 14, mito 6.5
Family & Domain DBs
Amino Acid Sequences MKSSSNTRKPRRSHKERIKTWKIDIPVLRAEGLKNSQVKEEEEVRYNMKELWEGTYYIEKRLDKETYIVYDDKGNKDLLHGNRLVYYRQVDRMIPQVNVVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.91
4 0.93
5 0.92
6 0.86
7 0.81
8 0.75
9 0.67
10 0.63
11 0.55
12 0.48
13 0.41
14 0.37
15 0.32
16 0.27
17 0.25
18 0.21
19 0.21
20 0.21
21 0.2
22 0.19
23 0.21
24 0.22
25 0.23
26 0.23
27 0.25
28 0.23
29 0.23
30 0.24
31 0.23
32 0.22
33 0.21
34 0.18
35 0.14
36 0.13
37 0.11
38 0.12
39 0.11
40 0.11
41 0.12
42 0.18
43 0.18
44 0.19
45 0.23
46 0.2
47 0.21
48 0.25
49 0.25
50 0.19
51 0.21
52 0.21
53 0.19
54 0.22
55 0.21
56 0.17
57 0.22
58 0.24
59 0.25
60 0.24
61 0.23
62 0.2
63 0.22
64 0.28
65 0.26
66 0.28
67 0.26
68 0.26
69 0.29
70 0.31
71 0.29
72 0.26
73 0.27
74 0.25
75 0.29
76 0.31
77 0.28
78 0.29
79 0.36
80 0.36
81 0.32