Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9Z5D7

Protein Details
Accession A0A2T9Z5D7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
95-117IIESRQRYIDRQKRKENKALIESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR044608  Ect1/PCYT2  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0004306  F:ethanolamine-phosphate cytidylyltransferase activity  
GO:0006646  P:phosphatidylethanolamine biosynthetic process  
Amino Acid Sequences MVKGGNFPVMNLQERVLGVLQCRYVDEVIIGAPYSVTKDVLEKVYKVDVVAHGPDKPILDLDGNDPYKLPKELGIYKEVNHELTSLTTTTIINRIIESRQRYIDRQKRKENKALIESEMEAVTSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.19
4 0.16
5 0.14
6 0.16
7 0.17
8 0.15
9 0.16
10 0.16
11 0.14
12 0.13
13 0.12
14 0.09
15 0.08
16 0.08
17 0.07
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.07
24 0.07
25 0.09
26 0.11
27 0.15
28 0.16
29 0.15
30 0.16
31 0.17
32 0.17
33 0.16
34 0.15
35 0.12
36 0.12
37 0.14
38 0.13
39 0.12
40 0.12
41 0.13
42 0.12
43 0.11
44 0.09
45 0.08
46 0.07
47 0.07
48 0.09
49 0.15
50 0.15
51 0.14
52 0.14
53 0.14
54 0.15
55 0.15
56 0.14
57 0.09
58 0.14
59 0.18
60 0.2
61 0.25
62 0.24
63 0.24
64 0.29
65 0.27
66 0.24
67 0.19
68 0.18
69 0.13
70 0.13
71 0.14
72 0.09
73 0.09
74 0.09
75 0.08
76 0.09
77 0.12
78 0.12
79 0.11
80 0.11
81 0.13
82 0.16
83 0.22
84 0.26
85 0.27
86 0.32
87 0.35
88 0.4
89 0.49
90 0.55
91 0.6
92 0.65
93 0.72
94 0.76
95 0.81
96 0.85
97 0.83
98 0.82
99 0.79
100 0.73
101 0.65
102 0.58
103 0.5
104 0.43
105 0.34
106 0.26