Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YA92

Protein Details
Accession A0A2T9YA92   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-41RAWRIPWKLNKTRKANVRKRLSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12.333, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGSYFGAFRASFVPFGGRAWRIPWKLNKTRKANVRKRLSAVDDVIQTLVDSGVQLKSLELAKALPKEHEMLPKNKYTTFSRVTKTHRKGVHKVPKFTKVPIPRTMPVGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.15
4 0.19
5 0.18
6 0.17
7 0.21
8 0.29
9 0.29
10 0.35
11 0.43
12 0.48
13 0.57
14 0.65
15 0.71
16 0.7
17 0.76
18 0.79
19 0.81
20 0.8
21 0.8
22 0.8
23 0.76
24 0.71
25 0.68
26 0.63
27 0.55
28 0.47
29 0.4
30 0.31
31 0.26
32 0.22
33 0.17
34 0.13
35 0.09
36 0.07
37 0.04
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.06
45 0.07
46 0.07
47 0.06
48 0.07
49 0.1
50 0.12
51 0.13
52 0.12
53 0.13
54 0.16
55 0.18
56 0.25
57 0.26
58 0.29
59 0.32
60 0.36
61 0.37
62 0.36
63 0.38
64 0.34
65 0.37
66 0.38
67 0.4
68 0.41
69 0.45
70 0.52
71 0.59
72 0.6
73 0.61
74 0.63
75 0.65
76 0.68
77 0.72
78 0.75
79 0.73
80 0.77
81 0.76
82 0.78
83 0.73
84 0.7
85 0.69
86 0.67
87 0.65
88 0.64
89 0.64
90 0.57