Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2U8X3

Protein Details
Accession Q2U8X3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
32-54DLNIRSRKIPKGNMKRTKKYASQHydrophilic
NLS Segment(s)
PositionSequence
39-47KIPKGNMKR
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009413  Aegerolysin-typ  
Gene Ontology GO:0019836  P:hemolysis by symbiont of host erythrocytes  
Pfam View protein in Pfam  
PF06355  Aegerolysin  
Amino Acid Sequences MALCLCQQSKISGAQELIRLLFDIDLLHLLIDLNIRSRKIPKGNMKRTKKYASQVNGKEIIPGTSQLLETCGRSSAASGTEGTLELWDKTQRICKLYWDCPWGSKVNKFKVQEKYKTYRVEVGPWNSYGGALGNVDVEISRKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.26
4 0.24
5 0.18
6 0.17
7 0.14
8 0.12
9 0.1
10 0.07
11 0.06
12 0.07
13 0.06
14 0.06
15 0.05
16 0.06
17 0.06
18 0.07
19 0.07
20 0.11
21 0.13
22 0.14
23 0.16
24 0.2
25 0.26
26 0.32
27 0.41
28 0.47
29 0.57
30 0.67
31 0.75
32 0.81
33 0.83
34 0.83
35 0.8
36 0.75
37 0.71
38 0.69
39 0.66
40 0.66
41 0.61
42 0.58
43 0.55
44 0.48
45 0.43
46 0.34
47 0.28
48 0.19
49 0.16
50 0.12
51 0.1
52 0.1
53 0.08
54 0.1
55 0.09
56 0.09
57 0.09
58 0.08
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.08
65 0.08
66 0.07
67 0.07
68 0.08
69 0.07
70 0.07
71 0.06
72 0.06
73 0.07
74 0.08
75 0.08
76 0.1
77 0.16
78 0.19
79 0.2
80 0.21
81 0.28
82 0.34
83 0.39
84 0.43
85 0.41
86 0.39
87 0.39
88 0.41
89 0.38
90 0.35
91 0.38
92 0.41
93 0.44
94 0.51
95 0.53
96 0.57
97 0.63
98 0.68
99 0.69
100 0.69
101 0.68
102 0.68
103 0.7
104 0.65
105 0.62
106 0.55
107 0.54
108 0.53
109 0.51
110 0.47
111 0.42
112 0.41
113 0.33
114 0.31
115 0.24
116 0.17
117 0.12
118 0.09
119 0.09
120 0.08
121 0.08
122 0.08
123 0.07
124 0.09