Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YJE3

Protein Details
Accession A0A2T9YJE3    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-42KPLYGIEKKKVQKKIDRNKQTKKYKHYQKALQETQSHydrophilic
103-125RDIARQKKEKAGARKKRKITTFLBasic
NLS Segment(s)
PositionSequence
11-29GIEKKKVQKKIDRNKQTKK
74-87SKKSDRFGKVVRER
92-120RVREELREERERDIARQKKEKAGARKKRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MDKKYRKPLYGIEKKKVQKKIDRNKQTKKYKHYQKALQETQSEEKTLEQPAFLKNLLENAEGVEKEDGKGIERSKKSDRFGKVVREREEEDRVREELREERERDIARQKKEKAGARKKRKITTFLATKKTSRGQPVISSKINLLLGKIETGAKYNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.79
4 0.77
5 0.76
6 0.79
7 0.82
8 0.84
9 0.87
10 0.89
11 0.91
12 0.92
13 0.93
14 0.91
15 0.89
16 0.88
17 0.88
18 0.88
19 0.87
20 0.85
21 0.84
22 0.85
23 0.83
24 0.77
25 0.68
26 0.62
27 0.58
28 0.5
29 0.41
30 0.31
31 0.26
32 0.23
33 0.23
34 0.18
35 0.13
36 0.14
37 0.14
38 0.16
39 0.15
40 0.13
41 0.11
42 0.14
43 0.15
44 0.14
45 0.12
46 0.11
47 0.12
48 0.12
49 0.13
50 0.1
51 0.09
52 0.09
53 0.1
54 0.09
55 0.09
56 0.13
57 0.14
58 0.21
59 0.22
60 0.27
61 0.33
62 0.38
63 0.4
64 0.44
65 0.45
66 0.43
67 0.46
68 0.51
69 0.52
70 0.54
71 0.54
72 0.51
73 0.5
74 0.48
75 0.51
76 0.43
77 0.38
78 0.33
79 0.31
80 0.28
81 0.25
82 0.23
83 0.21
84 0.26
85 0.3
86 0.29
87 0.3
88 0.35
89 0.36
90 0.38
91 0.43
92 0.43
93 0.44
94 0.51
95 0.51
96 0.53
97 0.59
98 0.63
99 0.64
100 0.68
101 0.72
102 0.75
103 0.82
104 0.83
105 0.84
106 0.82
107 0.77
108 0.72
109 0.71
110 0.7
111 0.69
112 0.68
113 0.63
114 0.59
115 0.59
116 0.59
117 0.54
118 0.51
119 0.48
120 0.44
121 0.5
122 0.56
123 0.57
124 0.53
125 0.49
126 0.43
127 0.42
128 0.42
129 0.33
130 0.25
131 0.22
132 0.2
133 0.19
134 0.2
135 0.17
136 0.15