Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YM70

Protein Details
Accession A0A2T9YM70    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
105-124MCTKTSQCSKCKIKTQRISHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, mito 4, pero 3
Family & Domain DBs
Amino Acid Sequences MDNKNKNTNTKIVVEQSPLMPDRITRIDRQYLATPPPRICESGSVDTVIDVIPGQNTGSPRKQPVYVRLDGSGVCIDGGEHDWIRSVPFAFVCCGGVCGLLFEGMCTKTSQCSKCKIKTQRISH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.33
4 0.33
5 0.3
6 0.26
7 0.2
8 0.18
9 0.2
10 0.24
11 0.26
12 0.25
13 0.3
14 0.35
15 0.36
16 0.4
17 0.38
18 0.35
19 0.39
20 0.41
21 0.4
22 0.35
23 0.37
24 0.35
25 0.33
26 0.3
27 0.28
28 0.28
29 0.28
30 0.27
31 0.24
32 0.22
33 0.21
34 0.2
35 0.15
36 0.08
37 0.05
38 0.04
39 0.03
40 0.04
41 0.04
42 0.05
43 0.07
44 0.11
45 0.14
46 0.16
47 0.19
48 0.2
49 0.24
50 0.25
51 0.32
52 0.34
53 0.34
54 0.33
55 0.31
56 0.31
57 0.26
58 0.26
59 0.17
60 0.11
61 0.08
62 0.07
63 0.06
64 0.06
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.08
71 0.09
72 0.1
73 0.09
74 0.08
75 0.09
76 0.1
77 0.1
78 0.11
79 0.11
80 0.1
81 0.1
82 0.09
83 0.09
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.06
90 0.09
91 0.09
92 0.1
93 0.11
94 0.11
95 0.17
96 0.26
97 0.31
98 0.34
99 0.43
100 0.52
101 0.59
102 0.69
103 0.73
104 0.76