Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9YVC5

Protein Details
Accession A0A2T9YVC5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-58NKSRVTKKSAEKPATKKKAKBasic
NLS Segment(s)
PositionSequence
39-162NKSRVTKKSAEKPATKKKAKTVKKVASKVVSELTPKAKKSKAVSVAETKTKKSAKEEKPKKAAVEKPKAKVAPKKVPAVSSPTKRKAEKESIPVASPKRTRAPAKVEAKKPAKKAAATKKTKSK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005819  H1/H5  
Gene Ontology GO:0000786  C:nucleosome  
GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
GO:0006334  P:nucleosome assembly  
Amino Acid Sequences MAEKNSTKQADGSAVRRSSRSKTQVKTGYVPEIVKRVQNKSRVTKKSAEKPATKKKAKTVKKVASKVVSELTPKAKKSKAVSVAETKTKKSAKEEKPKKAAVEKPKAKVAPKKVPAVSSPTKRKAEKESIPVASPKRTRAPAKVEAKKPAKKAAATKKTKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.41
4 0.43
5 0.41
6 0.47
7 0.52
8 0.53
9 0.53
10 0.62
11 0.67
12 0.67
13 0.66
14 0.6
15 0.56
16 0.5
17 0.47
18 0.39
19 0.36
20 0.33
21 0.32
22 0.33
23 0.35
24 0.37
25 0.44
26 0.5
27 0.55
28 0.64
29 0.66
30 0.66
31 0.67
32 0.7
33 0.72
34 0.74
35 0.71
36 0.69
37 0.73
38 0.79
39 0.81
40 0.79
41 0.72
42 0.72
43 0.75
44 0.75
45 0.76
46 0.75
47 0.74
48 0.77
49 0.78
50 0.75
51 0.69
52 0.61
53 0.52
54 0.44
55 0.36
56 0.27
57 0.25
58 0.27
59 0.26
60 0.26
61 0.29
62 0.28
63 0.32
64 0.34
65 0.39
66 0.4
67 0.39
68 0.41
69 0.43
70 0.44
71 0.46
72 0.44
73 0.37
74 0.35
75 0.34
76 0.33
77 0.34
78 0.41
79 0.44
80 0.54
81 0.63
82 0.67
83 0.72
84 0.73
85 0.69
86 0.66
87 0.64
88 0.63
89 0.64
90 0.62
91 0.58
92 0.62
93 0.62
94 0.59
95 0.6
96 0.59
97 0.58
98 0.57
99 0.61
100 0.56
101 0.55
102 0.51
103 0.51
104 0.5
105 0.49
106 0.53
107 0.54
108 0.59
109 0.59
110 0.61
111 0.62
112 0.64
113 0.61
114 0.6
115 0.59
116 0.55
117 0.55
118 0.56
119 0.51
120 0.49
121 0.45
122 0.43
123 0.43
124 0.47
125 0.51
126 0.53
127 0.58
128 0.6
129 0.67
130 0.71
131 0.7
132 0.73
133 0.77
134 0.77
135 0.74
136 0.73
137 0.69
138 0.65
139 0.7
140 0.71
141 0.72
142 0.74