Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Z1G7

Protein Details
Accession A0A2T9Z1G7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-27DSTTPPSRSMRKECHKNRDLYFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 6.5, cyto_pero 4.5, mito 3, pero 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003213  Cyt_c_oxidase_su6B  
IPR036549  Cyt_c_oxidase_su6B_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0045277  C:respiratory chain complex IV  
Pfam View protein in Pfam  
PF02297  COX6B  
Amino Acid Sequences MNEPKDSTTPPSRSMRKECHKNRDLYFECLKVNKIDLPSEAGPTICSAEKKGMYDKCPHTWADYFIQLQELTKQREKALKAVQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.69
4 0.76
5 0.8
6 0.81
7 0.81
8 0.81
9 0.76
10 0.76
11 0.69
12 0.64
13 0.58
14 0.5
15 0.44
16 0.38
17 0.36
18 0.26
19 0.24
20 0.2
21 0.18
22 0.16
23 0.15
24 0.18
25 0.18
26 0.18
27 0.16
28 0.14
29 0.12
30 0.11
31 0.12
32 0.08
33 0.08
34 0.08
35 0.11
36 0.13
37 0.14
38 0.21
39 0.23
40 0.26
41 0.33
42 0.37
43 0.38
44 0.4
45 0.39
46 0.36
47 0.34
48 0.35
49 0.31
50 0.3
51 0.26
52 0.24
53 0.25
54 0.21
55 0.2
56 0.23
57 0.25
58 0.28
59 0.33
60 0.35
61 0.37
62 0.44
63 0.46
64 0.48