Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T9XY97

Protein Details
Accession A0A2T9XY97    Localization Confidence High Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-69EIDKESNSKKKRDEKPESIKNKKSKKSEKVESKKSDVEKSKKSEKKKEKKSGKEKPKVKDLVBasic
118-147NDKTIEKEPKKPKREKVKGKSKPPKVDPVABasic
161-187LSEWKHSRSTWKFKKSRQLWLCRNAFKHydrophilic
NLS Segment(s)
PositionSequence
15-66SKKKRDEKPESIKNKKSKKSEKVESKKSDVEKSKKSEKKKEKKSGKEKPKVK
122-143IEKEPKKPKREKVKGKSKPPKV
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019327  WKF  
Pfam View protein in Pfam  
PF10180  WKF  
Amino Acid Sequences MDESKSIEIDKESNSKKKRDEKPESIKNKKSKKSEKVESKKSDVEKSKKSEKKKEKKSGKEKPKVKDLVESKESDSTLDSEKQKENKEKETKVSEEATIEIKKRKHDSKETNTEKNENDKTIEKEPKKPKREKVKGKSKPPKVDPVAEGMKVAKRESLSYLSEWKHSRSTWKFKKSRQLWLCRNAFKLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.6
4 0.68
5 0.74
6 0.76
7 0.79
8 0.8
9 0.85
10 0.89
11 0.9
12 0.9
13 0.89
14 0.88
15 0.87
16 0.85
17 0.85
18 0.85
19 0.85
20 0.85
21 0.87
22 0.88
23 0.89
24 0.9
25 0.86
26 0.82
27 0.78
28 0.72
29 0.71
30 0.69
31 0.66
32 0.64
33 0.64
34 0.69
35 0.69
36 0.74
37 0.76
38 0.77
39 0.8
40 0.83
41 0.87
42 0.87
43 0.91
44 0.93
45 0.93
46 0.93
47 0.92
48 0.89
49 0.84
50 0.83
51 0.78
52 0.68
53 0.65
54 0.59
55 0.56
56 0.52
57 0.48
58 0.39
59 0.37
60 0.35
61 0.27
62 0.23
63 0.16
64 0.16
65 0.19
66 0.19
67 0.19
68 0.23
69 0.28
70 0.33
71 0.4
72 0.41
73 0.46
74 0.52
75 0.51
76 0.52
77 0.53
78 0.48
79 0.43
80 0.41
81 0.31
82 0.24
83 0.22
84 0.2
85 0.17
86 0.17
87 0.18
88 0.19
89 0.23
90 0.29
91 0.34
92 0.38
93 0.46
94 0.55
95 0.6
96 0.69
97 0.71
98 0.72
99 0.68
100 0.65
101 0.57
102 0.55
103 0.48
104 0.38
105 0.34
106 0.3
107 0.32
108 0.36
109 0.44
110 0.39
111 0.47
112 0.56
113 0.64
114 0.7
115 0.74
116 0.76
117 0.78
118 0.86
119 0.88
120 0.88
121 0.89
122 0.89
123 0.92
124 0.93
125 0.91
126 0.9
127 0.84
128 0.83
129 0.77
130 0.73
131 0.62
132 0.59
133 0.53
134 0.43
135 0.38
136 0.3
137 0.29
138 0.25
139 0.24
140 0.2
141 0.17
142 0.18
143 0.22
144 0.24
145 0.23
146 0.24
147 0.31
148 0.29
149 0.35
150 0.35
151 0.35
152 0.35
153 0.34
154 0.42
155 0.45
156 0.54
157 0.59
158 0.68
159 0.73
160 0.76
161 0.86
162 0.82
163 0.84
164 0.83
165 0.83
166 0.82
167 0.83
168 0.84
169 0.79
170 0.76