Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y2X0

Protein Details
Accession A0A2T9Y2X0   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-104TIILPEPKKKNKSKKKSKKSKKEKKENESDTSDBasic
138-160IKDLLSEKSKQKERKHKIEVIEHBasic
NLS Segment(s)
PositionSequence
78-96PKKKNKSKKKSKKSKKEKK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, cyto 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027921  NOPCHAP1  
Gene Ontology GO:0000492  P:box C/D snoRNP assembly  
Pfam View protein in Pfam  
PF15370  NOPCHAP1  
Amino Acid Sequences MDPPSSLLDKLKSFLPLMEQENKTLEESIKIDPKKHLLETDGMGKEYIEMDLGLGVFDVTDGLKDNVSGIDTIILPEPKKKNKSKKKSKKSKKEKKENESDTSDESRESETVQNFTLECISSHTSEASEDENGKEKFIKDLLSEKSKQKERKHKIEVIEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.28
5 0.36
6 0.34
7 0.33
8 0.35
9 0.36
10 0.32
11 0.28
12 0.24
13 0.18
14 0.2
15 0.23
16 0.29
17 0.29
18 0.3
19 0.31
20 0.37
21 0.38
22 0.37
23 0.34
24 0.29
25 0.3
26 0.3
27 0.34
28 0.3
29 0.26
30 0.24
31 0.21
32 0.19
33 0.17
34 0.14
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.02
47 0.03
48 0.04
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.06
60 0.07
61 0.08
62 0.08
63 0.14
64 0.19
65 0.25
66 0.33
67 0.41
68 0.51
69 0.61
70 0.72
71 0.78
72 0.84
73 0.88
74 0.92
75 0.95
76 0.95
77 0.96
78 0.95
79 0.95
80 0.95
81 0.94
82 0.92
83 0.92
84 0.87
85 0.81
86 0.74
87 0.65
88 0.58
89 0.5
90 0.41
91 0.3
92 0.25
93 0.2
94 0.16
95 0.16
96 0.16
97 0.15
98 0.16
99 0.17
100 0.17
101 0.15
102 0.16
103 0.15
104 0.11
105 0.09
106 0.12
107 0.14
108 0.14
109 0.15
110 0.15
111 0.14
112 0.14
113 0.15
114 0.13
115 0.13
116 0.13
117 0.14
118 0.21
119 0.21
120 0.22
121 0.23
122 0.21
123 0.23
124 0.23
125 0.24
126 0.19
127 0.26
128 0.32
129 0.37
130 0.41
131 0.44
132 0.53
133 0.59
134 0.66
135 0.69
136 0.74
137 0.77
138 0.83
139 0.86
140 0.83