Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Z401

Protein Details
Accession A0A2T9Z401   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-98DLRNKKTRAIRRALKRSERTKVTLRKQKKNTHFSQRQYAVKHydrophilic
NLS Segment(s)
PositionSequence
44-86KKALEASKGKRTPLDLRNKKTRAIRRALKRSERTKVTLRKQKK
Subcellular Location(s) mito 16, nucl 8, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MKKDLVSLKVQQVAGSASASGYKVREMRKDVARVLTVITQQDRKKALEASKGKRTPLDLRNKKTRAIRRALKRSERTKVTLRKQKKNTHFSQRQYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.14
4 0.09
5 0.1
6 0.1
7 0.1
8 0.09
9 0.12
10 0.16
11 0.2
12 0.26
13 0.3
14 0.36
15 0.41
16 0.45
17 0.44
18 0.43
19 0.4
20 0.35
21 0.31
22 0.27
23 0.21
24 0.19
25 0.19
26 0.21
27 0.21
28 0.25
29 0.26
30 0.24
31 0.25
32 0.27
33 0.29
34 0.32
35 0.39
36 0.4
37 0.48
38 0.48
39 0.47
40 0.44
41 0.44
42 0.42
43 0.43
44 0.49
45 0.48
46 0.53
47 0.63
48 0.64
49 0.65
50 0.66
51 0.67
52 0.64
53 0.64
54 0.67
55 0.67
56 0.76
57 0.8
58 0.81
59 0.81
60 0.81
61 0.8
62 0.76
63 0.71
64 0.71
65 0.71
66 0.72
67 0.74
68 0.75
69 0.77
70 0.82
71 0.87
72 0.87
73 0.87
74 0.86
75 0.87
76 0.87
77 0.83
78 0.84
79 0.81