Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YUE9

Protein Details
Accession A0A2T9YUE9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-48VPFPKDSKTKAKTKTKKSKSENNDSSHydrophilic
NLS Segment(s)
PositionSequence
32-39KAKTKTKK
Subcellular Location(s) cyto 12.5, cyto_nucl 12, nucl 8.5, mito 6
Family & Domain DBs
Amino Acid Sequences RPTTLSIVLDEVYKTERKVDEIVPFPKDSKTKAKTKTKKSKSENNDSSIEYSIKSFESVSEFGNFVYEKSTEAVLAIKEASENIPEIEMGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.18
4 0.2
5 0.23
6 0.26
7 0.29
8 0.34
9 0.37
10 0.36
11 0.36
12 0.34
13 0.35
14 0.33
15 0.31
16 0.34
17 0.37
18 0.42
19 0.51
20 0.61
21 0.66
22 0.75
23 0.82
24 0.82
25 0.86
26 0.84
27 0.84
28 0.81
29 0.83
30 0.77
31 0.7
32 0.62
33 0.53
34 0.47
35 0.39
36 0.31
37 0.2
38 0.15
39 0.12
40 0.1
41 0.1
42 0.08
43 0.07
44 0.1
45 0.11
46 0.12
47 0.13
48 0.13
49 0.12
50 0.14
51 0.13
52 0.1
53 0.11
54 0.1
55 0.09
56 0.1
57 0.11
58 0.09
59 0.09
60 0.11
61 0.09
62 0.1
63 0.09
64 0.08
65 0.08
66 0.09
67 0.09
68 0.09
69 0.1
70 0.09
71 0.1