Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9YBT9

Protein Details
Accession A0A2T9YBT9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
31-60RRNPSCCPKEEKKEEKKEEKKEEKKCSGTTBasic
NLS Segment(s)
PositionSequence
42-51KKEEKKEEKK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MCHLCQPRPCQSANIWCEKCHWSSTWCNCFRRNPSCCPKEEKKEEKKEEKKEEKKCSGTTIVVTVRIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.47
3 0.44
4 0.46
5 0.45
6 0.42
7 0.34
8 0.3
9 0.25
10 0.33
11 0.42
12 0.47
13 0.51
14 0.52
15 0.54
16 0.58
17 0.61
18 0.61
19 0.56
20 0.55
21 0.58
22 0.59
23 0.58
24 0.6
25 0.6
26 0.6
27 0.66
28 0.68
29 0.68
30 0.75
31 0.82
32 0.84
33 0.86
34 0.87
35 0.87
36 0.88
37 0.87
38 0.87
39 0.88
40 0.86
41 0.82
42 0.75
43 0.69
44 0.63
45 0.56
46 0.48
47 0.44
48 0.38