Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9Y001

Protein Details
Accession A0A2T9Y001   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-32KTRNTFCPGKNCRKHTPHKVTQYKTGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRNTFCPGKNCRKHTPHKVTQYKTGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKIVLRLECNSCKYKTQMALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.74
4 0.78
5 0.79
6 0.84
7 0.84
8 0.85
9 0.84
10 0.85
11 0.87
12 0.81
13 0.82
14 0.8
15 0.73
16 0.66
17 0.61
18 0.51
19 0.43
20 0.42
21 0.39
22 0.37
23 0.36
24 0.41
25 0.43
26 0.47
27 0.51
28 0.55
29 0.53
30 0.56
31 0.63
32 0.6
33 0.61
34 0.59
35 0.58
36 0.56
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.28
46 0.33
47 0.38
48 0.47
49 0.55
50 0.6
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.68
57 0.64
58 0.61
59 0.63
60 0.6
61 0.55
62 0.51
63 0.46
64 0.41
65 0.39
66 0.4
67 0.39
68 0.45
69 0.49
70 0.54
71 0.63
72 0.68
73 0.74
74 0.71
75 0.66
76 0.6
77 0.53
78 0.52
79 0.52
80 0.53
81 0.52
82 0.54
83 0.51
84 0.49
85 0.48
86 0.42