Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2UB46

Protein Details
Accession Q2UB46    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-36CLPLAKPTRASKRRKFFQSPQGAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005176  PONY_dom  
PROSITE View protein in PROSITE  
PS51229  DCUN1  
Amino Acid Sequences MRTRSSGKSEYLCLPLAKPTRASKRRKFFQSPQGAGGATSSINKIFDSYRDSPDDNPDGIGIEGAMKFLGDIQVQLDEVTCLGIAELLKSPSMGEFTREGFLNGWRAVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.34
4 0.32
5 0.33
6 0.38
7 0.47
8 0.55
9 0.64
10 0.66
11 0.72
12 0.79
13 0.83
14 0.83
15 0.81
16 0.82
17 0.83
18 0.75
19 0.67
20 0.59
21 0.5
22 0.4
23 0.32
24 0.22
25 0.11
26 0.09
27 0.08
28 0.07
29 0.07
30 0.07
31 0.08
32 0.08
33 0.09
34 0.16
35 0.18
36 0.2
37 0.23
38 0.24
39 0.23
40 0.27
41 0.27
42 0.2
43 0.18
44 0.14
45 0.12
46 0.11
47 0.1
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.04
56 0.05
57 0.04
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.06
64 0.05
65 0.05
66 0.05
67 0.04
68 0.04
69 0.03
70 0.05
71 0.05
72 0.06
73 0.08
74 0.09
75 0.09
76 0.09
77 0.1
78 0.09
79 0.13
80 0.12
81 0.13
82 0.14
83 0.16
84 0.19
85 0.19
86 0.19
87 0.17
88 0.2
89 0.23