Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2U8R2

Protein Details
Accession Q2U8R2   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
138-157LEKARRNPKLMERLRRQGKLBasic
NLS Segment(s)
PositionSequence
129-157RREEARQKMLEKARRNPKLMERLRRQGKL
Subcellular Location(s) nucl 18, cyto 4, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011058  Cyanovirin-N  
IPR036673  Cyanovirin-N_sf  
KEGG aor:AO090701000326  -  
Pfam View protein in Pfam  
PF08881  CVNH  
Amino Acid Sequences MNIATTCNSWSIEHHRLEEERRWVTDLHCKAKKDNGEWISTQLRLDDILGNDDGNFKYSLRYPERNISSSMSNPRLEVTGDGRPILHGRLTTRDAYGHDRSLDLSKILWNKDGRLSLNEDVVRAEDDRRREEARQKMLEKARRNPKLMERLRRQGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.4
4 0.45
5 0.47
6 0.47
7 0.42
8 0.41
9 0.4
10 0.37
11 0.36
12 0.41
13 0.42
14 0.43
15 0.45
16 0.45
17 0.47
18 0.53
19 0.57
20 0.5
21 0.52
22 0.46
23 0.44
24 0.43
25 0.45
26 0.4
27 0.34
28 0.31
29 0.21
30 0.18
31 0.14
32 0.15
33 0.13
34 0.1
35 0.12
36 0.12
37 0.11
38 0.11
39 0.13
40 0.12
41 0.1
42 0.11
43 0.08
44 0.1
45 0.13
46 0.2
47 0.24
48 0.29
49 0.3
50 0.38
51 0.42
52 0.42
53 0.4
54 0.35
55 0.31
56 0.3
57 0.33
58 0.28
59 0.25
60 0.23
61 0.22
62 0.2
63 0.19
64 0.16
65 0.14
66 0.13
67 0.13
68 0.13
69 0.12
70 0.12
71 0.13
72 0.12
73 0.1
74 0.08
75 0.09
76 0.13
77 0.16
78 0.16
79 0.16
80 0.17
81 0.18
82 0.23
83 0.25
84 0.22
85 0.2
86 0.19
87 0.2
88 0.21
89 0.19
90 0.13
91 0.11
92 0.14
93 0.17
94 0.18
95 0.22
96 0.21
97 0.22
98 0.26
99 0.29
100 0.27
101 0.25
102 0.3
103 0.26
104 0.31
105 0.3
106 0.25
107 0.22
108 0.21
109 0.2
110 0.16
111 0.18
112 0.16
113 0.21
114 0.24
115 0.28
116 0.31
117 0.35
118 0.43
119 0.49
120 0.54
121 0.58
122 0.57
123 0.61
124 0.67
125 0.7
126 0.7
127 0.7
128 0.72
129 0.71
130 0.73
131 0.71
132 0.72
133 0.74
134 0.76
135 0.76
136 0.75
137 0.78