Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T9ZFZ6

Protein Details
Accession A0A2T9ZFZ6   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-60RANRKHSFSKKTPRAPKRAKSRVEBasic
NLS Segment(s)
PositionSequence
40-57RKHSFSKKTPRAPKRAKS
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043151  BAH_sf  
Amino Acid Sequences MEDLNETVPDGQDIQDATLDKEPDSGEQDDAEGYELRANRKHSFSKKTPRAPKRAKSRVEVVDTQNLKFLDSIVVRNTLCNNLEEVVEVGDFVHVLNEENDMGPLVAHVHNIWLDETRKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.15
5 0.18
6 0.18
7 0.16
8 0.18
9 0.17
10 0.17
11 0.2
12 0.19
13 0.16
14 0.15
15 0.15
16 0.13
17 0.13
18 0.13
19 0.09
20 0.07
21 0.1
22 0.11
23 0.14
24 0.18
25 0.22
26 0.24
27 0.28
28 0.37
29 0.41
30 0.48
31 0.55
32 0.62
33 0.67
34 0.74
35 0.79
36 0.8
37 0.83
38 0.83
39 0.83
40 0.83
41 0.83
42 0.77
43 0.7
44 0.69
45 0.63
46 0.58
47 0.53
48 0.44
49 0.43
50 0.4
51 0.36
52 0.33
53 0.27
54 0.23
55 0.19
56 0.17
57 0.13
58 0.13
59 0.14
60 0.12
61 0.15
62 0.15
63 0.16
64 0.17
65 0.16
66 0.16
67 0.15
68 0.15
69 0.12
70 0.12
71 0.12
72 0.11
73 0.09
74 0.08
75 0.07
76 0.06
77 0.05
78 0.05
79 0.04
80 0.05
81 0.04
82 0.05
83 0.06
84 0.07
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.07
91 0.07
92 0.08
93 0.08
94 0.09
95 0.09
96 0.1
97 0.11
98 0.12
99 0.13
100 0.15